PDB entry 1mvo

View 1mvo on RCSB PDB site
Description: Crystal structure of the PhoP receiver domain from Bacillus subtilis
Class: Transcription
Keywords: PHOSPHATE REGULON, TRANSCRIPTIONAL REGULATORY PROTEIN, ALPHA/BETA DOUBLY WOUND FOLD, RESPONSE REGULATOR, PHOSPHORYLATION, ASYMMETRIC INTERFACE, TANDEM ASSOCIATION, Structural Proteomics in Europe, SPINE, Structural Genomics
Deposited on 2002-09-26, released 2002-10-16
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.188
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: PhoP response regulator
    Species: Bacillus subtilis [TaxId:1423]
    Gene: PHOP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1mvoa_
  • Heterogens: MN, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1mvoA (A:)
    hmnkkilvvddeesivtllqynlersgydvitasdgeealkkaetekpdlivldvmlpkl
    dgievckqlrqqklmfpilmltakdeefdkvlglelgaddymtkpfsprevnarvkailr
    rseirapssemkndem
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mvoA (A:)
    mnkkilvvddeesivtllqynlersgydvitasdgeealkkaetekpdlivldvmlpkld
    gievckqlrqqklmfpilmltakdeefdkvlglelgaddymtkpfsprevnarvkailrr
    s