PDB entry 1mvo

View 1mvo on RCSB PDB site
Description: Crystal structure of the PhoP receiver domain from Bacillus subtilis
Deposited on 2002-09-26, released 2002-10-16
The last revision prior to the SCOP 1.63 freeze date was dated 2003-02-11, with a file datestamp of 2003-02-11.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.188
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.63: d1mvoa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1mvoA (A:)
  mnkkilvvddeesivtllqynlersgydvitasdgeealkkaetekpdlivldvmlpkld
  gievckqlrqqklmfpilmltakdeefdkvlglelgaddymtkpfsprevnarvkailrr
  s