PDB entry 1mvg

View 1mvg on RCSB PDB site
Description: NMR solution structure of chicken Liver basic Fatty Acid Binding Protein (Lb-FABP)
Class: transport protein
Keywords: beta-barrel, Calycin, ten antiparallel beta strands, helix-turn-helix motif, fatty acid binding protein, TRANSPORT PROTEIN
Deposited on 2002-09-25, released 2003-03-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Liver basic Fatty Acid Binding Protein
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1mvga_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mvgA (A:)
    afsgtwqvyaqenyeeflkalalpedlikmardikpiveiqqkgddfvvtsktprqtvtn
    sftlgkeadittmdgkklkctvhlangklvtksekfsheqevkgnemvetitfggvtlir
    rskrv