PDB entry 1mvf

View 1mvf on RCSB PDB site
Description:
Deposited on 2002-09-25, released 2003-06-10
The last revision prior to the SCOP 1.65 freeze date was dated 2003-06-10, with a file datestamp of 2003-06-10.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.218
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1mvfa_
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1mvfb_
  • Chain 'D':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1mvfd_
  • Chain 'E':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1mvfe_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1mvfA (A:)
    qvqlvesgggsvqaggslrlscaasgftysrkymgwfrqapgkeregvaaifidngntiy
    adsvqgrftisqdnakntvylqmnslkpedtamyycaassrwmdysaltakaynswgqgt
    qvtvssrgrhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mvfA (A:)
    qvqlvesgggsvqaggslrlscaasgftysrkymgwfrqapgkeregvaaifidngntiy
    adsvqgrftisqdnakntvylqmnslkpedtamyycaassrwmdysaltakaynswgqgt
    qvtvssr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1mvfB (B:)
    qvqlvesgggsvqaggslrlscaasgftysrkymgwfrqapgkeregvaaifidngntiy
    adsvqgrftisqdnakntvylqmnslkpedtamyycaassrwmdysaltakaynswgqgt
    qvtvssrgrhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mvfB (B:)
    qlvesgggsvqaggslrlscaasgfsrkymgwfrqapgkeregvaaifidngntiyadsv
    qgrftisqdnakntvylqmnslkpedtamyycaassrwmdysaltakaynswgqgtqvtv
    ss
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1mvfD (D:)
    mihssvkrwgnspavripatlmqalnlniddevkidlvdgkliiepvrkepvftlaelvn
    ditpenlhenidwgepkdkevw
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mvfD (D:)
    ssvkrwgnspavripatlmqalnlniddevkidlvdgkliiepv
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1mvfE (E:)
    mihssvkrwgnspavripatlmqalnlniddevkidlvdgkliiepvrkepvftlaelvn
    ditpenlhenidwgepkdkevw
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mvfE (E:)
    ssvkrwgnspavripatlmqalnlniddevkidlvdgkliiepv