PDB entry 1mvf

View 1mvf on RCSB PDB site
Description: MazE addiction antidote
Class: immune system
Keywords: plasmid addiction, camel antibody, addiction antidote, IMMUNE SYSTEM
Deposited on 2002-09-25, released 2003-06-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-04-11, with a file datestamp of 2012-04-06.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.218
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: immunoglobulin heavy chain variable region
    Species: Camelus dromedarius [TaxId:9838]
    Database cross-references and differences (RAF-indexed):
    • PDB 1MVF (0-End)
    Domains in SCOPe 2.07: d1mvfa_
  • Chain 'B':
    Compound: immunoglobulin heavy chain variable region
    Species: Camelus dromedarius [TaxId:9838]
    Database cross-references and differences (RAF-indexed):
    • PDB 1MVF
    Domains in SCOPe 2.07: d1mvfb_
  • Chain 'D':
    Compound: PemI-like protein 1
    Species: Escherichia coli [TaxId:562]
    Gene: MazE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1mvfd_
  • Chain 'E':
    Compound: PemI-like protein 1
    Species: Escherichia coli [TaxId:562]
    Gene: MazE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1mvfe_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1mvfA (A:)
    qvqlvesgggsvqaggslrlscaasgftysrkymgwfrqapgkeregvaaifidngntiy
    adsvqgrftisqdnakntvylqmnslkpedtamyycaassrwmdysaltakaynswgqgt
    qvtvssrgrhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mvfA (A:)
    qvqlvesgggsvqaggslrlscaasgftysrkymgwfrqapgkeregvaaifidngntiy
    adsvqgrftisqdnakntvylqmnslkpedtamyycaassrwmdysaltakaynswgqgt
    qvtvssr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1mvfB (B:)
    qvqlvesgggsvqaggslrlscaasgftysrkymgwfrqapgkeregvaaifidngntiy
    adsvqgrftisqdnakntvylqmnslkpedtamyycaassrwmdysaltakaynswgqgt
    qvtvssrgrhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mvfB (B:)
    qlvesgggsvqaggslrlscaasgfsrkymgwfrqapgkeregvaaifidngntiyadsv
    qgrftisqdnakntvylqmnslkpedtamyycaassrwmdysaltakaynswgqgtqvtv
    ss
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1mvfD (D:)
    mihssvkrwgnspavripatlmqalnlniddevkidlvdgkliiepvrkepvftlaelvn
    ditpenlhenidwgepkdkevw
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mvfD (D:)
    ssvkrwgnspavripatlmqalnlniddevkidlvdgkliiepv
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1mvfE (E:)
    mihssvkrwgnspavripatlmqalnlniddevkidlvdgkliiepvrkepvftlaelvn
    ditpenlhenidwgepkdkevw
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mvfE (E:)
    ssvkrwgnspavripatlmqalnlniddevkidlvdgkliiepv