PDB entry 1mv9

View 1mv9 on RCSB PDB site
Description: Crystal Structure of the human RXR alpha ligand binding domain bound to the eicosanoid DHA (Docosa Hexaenoic Acid) and a coactivator peptide
Deposited on 2002-09-24, released 2002-10-16
The last revision prior to the SCOP 1.71 freeze date was dated 2002-10-16, with a file datestamp of 2002-10-16.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.201
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1mv9a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1mv9A (A:)
    tssanedmpverileaelavepktetyveanmglnpsspndpvtnicqaadkqlftlvew
    akriphfselplddqvillragwnelliasfshrsiavkdgillatglhvhrnsahsagv
    gaifdrvltelvskmrdmqmdktelgclraivlfnpdskglsnpaevealrekvyaslea
    yckhkypeqpgrfaklllrlpalrsiglkclehlfffkligdtpidtflmemleaphqmt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mv9A (A:)
    dmpverileaelavepdpvtnicqaadkqlftlvewakriphfselplddqvillragwn
    elliasfshrsiavkdgillatglhvhrnsahsagvgaifdrvltelvskmrdmqmdkte
    lgclraivlfnpdskglsnpaevealrekvyasleayckhkypeqpgrfaklllrlpalr
    siglkclehlfffkligdtpidtflmemleaphq