PDB entry 1muw

View 1muw on RCSB PDB site
Description: The 0.86 Angstrom Structure of Xylose Isomerase
Class: isomerase
Keywords: xylose isomerase, atomic resolution, disorder, ISOMERASE
Deposited on 2002-09-24, released 2002-11-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 0.86 Å
R-factor: 0.126
AEROSPACI score: 1.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: xylose isomerase
    Species: Streptomyces olivochromogenes [TaxId:1963]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15587 (0-385)
      • see remark 999 (174)
    Domains in SCOPe 2.07: d1muwa_
  • Heterogens: MN, MG, OH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1muwA (A:)
    syqptpedrftfglwtvgwqgrdpfgdatrpaldpvetvqrlaelgahgvtfhdddlipf
    gssdtereshikrfrqaldatgmtvpmattnlfthpvfkdggftandrdvrryalrktir
    nidlavelgaktyvawggregaesgaakdvrvaldrmkeafdllgeyvtsqgydirfaie
    pkpneprgdillptvghalafierlerpelygvnpevgheqmaglnfphgiaqalwagkl
    fhidlngqsgikydqdlrfgagdlraafwlvdllesagyegprhfdfkpprtedidgvwa
    saagcmrnylilkeraaafradpevqealrasrldelaqptaadgvqelladrtafedfd
    vdaaaargmaferldqlamdhllgar