PDB entry 1mut

View 1mut on RCSB PDB site
Description: nmr study of mutt enzyme, a nucleoside triphosphate pyrophosphohydrolase
Class: DNA repair
Keywords: DNA repair
Deposited on 1995-09-14, released 1996-04-03
The last revision prior to the SCOP 1.75 freeze date was dated 1996-04-03, with a file datestamp of 2007-06-04.
Experiment type: NMR15
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nucleoside triphosphate pyrophosphohydrolase
    Species: Escherichia coli
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1muta_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mutA (A:)
    mkklqiavgiirnenneifitrraadahmanklefpggkiemgetpeqavvrelqeevgi
    tpqhfslfekleyefpdrhitlwfwlverwegepwgkegqpgewmslvglnaddfppane
    pviaklkrl