PDB entry 1mus

View 1mus on RCSB PDB site
Description: crystal structure of Tn5 transposase complexed with resolved outside end DNA
Class: transcription/DNA
Keywords: transposase, hairpin, dna binding, TRANSCRIPTION/DNA COMPLEX
Deposited on 2002-09-24, released 2002-09-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.193
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tn5 Transposase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q46731 (Start-475)
      • engineered (53)
      • engineered (55)
      • engineered (118-119)
      • engineered (344)
      • engineered (371)
      • cloning artifact (476)
    Domains in SCOPe 2.07: d1musa1, d1musa2
  • Chain 'B':
    Compound: DNA transferred strand
    Species: synthetic, synthetic
  • Chain 'C':
    Compound: DNA non-transferred strand
    Species: synthetic, synthetic
  • Heterogens: MN, MG, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1musA (A:)
    mitsalhraadwaksvfssaalgdprrtarlvnvaaqlakysgksitissegskaaqega
    yrfirnpnvsaeairkagamqtvklaqefpellaiedttslsyrhqvaeelgklgsiqka
    srgwwvhsvllleattfrtvgllhqewwmrpddpadadekesgkwlaaaatsrlrmgsmm
    snviavcdreadihaylqdklahnerfvvrskhprkdvesglylydhlknqpelggyqis
    ipqkgvvdkrgkrknrparkaslslrsgritlkqgnitlnavlaeeinppkgetplkwll
    ltsepveslaqalrvidiythrwrieefhkawktgagaerqrmekpdnlermvsilsfva
    vrllqlresftppqalraqgllkeaehvesqsaetvltpdecqllgyldkgkrkrkekag
    slqwaymaiarlggfmdskrtgiaswgalwegwealqskldgflaakdlmaqgikig
    

    Sequence, based on observed residues (ATOM records): (download)
    >1musA (A:)
    salhraadwaksvfssaalgdprrtarlvnvaaqlakysgksitissegskaaqegayrf
    irnpnvsaeairkagamqtvklaqefpellaiedttslsyrhqvaeelgklgsiqkasrg
    wwvhsvllleattfrtvgllhqewwmrpddpadadekesgkwlaaaatsrlrmgsmmsnv
    iavcdreadihaylqdklahnerfvvrskhprkdvesglylydhlknqpelggyqisipq
    kgvvdkrgkrknrparkaslslrsgritlkqgnitlnavlaeeinppkgetplkwlllts
    epveslaqalrvidiythrwrieefhkawktgagaerqrmekpdnlermvsilsfvavrl
    lqlresftppsqsaetvltpdecqllgyldkgkrkrkekagslqwaymaiarlggfmdsk
    rtgiaswgalwegwealqskldgflaakdlmaqgikig
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.