PDB entry 1mun

View 1mun on RCSB PDB site
Description: catalytic domain of muty from escherichia coli d138n mutant
Deposited on 1998-08-26, released 1999-08-26
The last revision prior to the SCOP 1.55 freeze date was dated 1999-08-26, with a file datestamp of 1999-08-25.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: 0.124
AEROSPACI score: 0.88 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1mun__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mun_ (-)
    mqasqfsaqvldwydkygrktlpwqidktpykvwlsevmlqqtqvatvipyferfmarfp
    tvtdlanapldevlhlwtglgyyararnlhkaaqqvatlhggkfpetfeevaalpgvgrs
    tagailslslgkhfpilngnvkrvlarcyavsgwpgkkevenklwslseqvtpavgverf
    nqammdlgamictrskpkcslcplqngciaaannswalypgkkpk