PDB entry 1mum

View 1mum on RCSB PDB site
Description: Structure of the 2-Methylisocitrate Lyase (PrpB) from Escherichia coli
Class: Lyase
Keywords: PrpB, lyase, methylisocitrate, methylcitrate cycle, TIM-barrel
Deposited on 2002-09-24, released 2003-04-29
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.213
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2-methylisocitrate lyase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1muma_
  • Chain 'B':
    Compound: 2-methylisocitrate lyase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1mumb_
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1mumA (A:)
    slhspgkafraaltkenplqivgtinanhallaqragyqaiylsgggvaagslglpdlgi
    stlddvltdirritdvcslpllvdadigfgssafnvartvksmikagaaglhiedqvgak
    rcghrpnkaivskeemvdriraavdaktdpdfvimartdalavegldaaieraqayveag
    aemlfpeaitelamyrqfadavqvpilanitefgatplfttdelrsahvamalyplsafr
    amnraaehvynvlrqegtqksvidtmqtrnelyesinyyqyeekldnlfarsqvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mumA (A:)
    lhspgkafraaltkenplqivgtinanhallaqragyqaiylsgggvaagslglpdlgis
    tlddvltdirritdvcslpllvdadigfgssafnvartvksmikagaaglhiedqvgakr
    cghrpnkaivskeemvdriraavdaktdpdfvimartdalavegldaaieraqayveaga
    emlfpeaitelamyrqfadavqvpilanitefgatplfttdelrsahvamalyplsafra
    mnraaehvynvlrqegtqksvidtmqtrnelyesinyyqyeekldnlfa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1mumB (B:)
    slhspgkafraaltkenplqivgtinanhallaqragyqaiylsgggvaagslglpdlgi
    stlddvltdirritdvcslpllvdadigfgssafnvartvksmikagaaglhiedqvgak
    rcghrpnkaivskeemvdriraavdaktdpdfvimartdalavegldaaieraqayveag
    aemlfpeaitelamyrqfadavqvpilanitefgatplfttdelrsahvamalyplsafr
    amnraaehvynvlrqegtqksvidtmqtrnelyesinyyqyeekldnlfarsqvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mumB (B:)
    lhspgkafraaltkenplqivgtinanhallaqragyqaiylsgggvaagslglpdlgis
    tlddvltdirritdvcslpllvdadigfgssafnvartvksmikagaaglhiedqvgakr
    cghrpnkaivskeemvdriraavdaktdpdfvimartdalavegldaaieraqayveaga
    emlfpeaitelamyrqfadavqvpilanitefgatplfttdelrsahvamalyplsafra
    mnraaehvynvlrqegtqksvidtmqtrnelyesinyyqyeekldnlfa