PDB entry 1muj

View 1muj on RCSB PDB site
Description: Crystal structure of murine class II MHC I-Ab in complex with a human CLIP peptide
Class: immune system
Keywords: I-ab, clip, complex, antigen, immune system
Deposited on 2002-09-23, released 2003-02-18
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.22
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: H-2 class II histocompatibility antigen, A-B alpha chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14434 (Start-181)
      • cloning artifact (182-186)
    Domains in SCOPe 2.05: d1muja1, d1muja2
  • Chain 'B':
    Compound: H-2 class II histocompatibility antigen, A beta chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14483 (Start-188)
      • cloning artifact (189-192)
    Domains in SCOPe 2.05: d1mujb1, d1mujb2
  • Chain 'C':
    Compound: CLIP peptide
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1MUJ
  • Heterogens: NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1mujA (A:)
    eddieadhvgtygisvyqspgdigqytfefdgdelfyvdldkketvwmlpefgqlasfdp
    qgglqniavvkhnlgvltkrsnstpatneapqatvfpkspvllgqpntlicfvdnifppv
    initwlrnsksvadgvyetsffvnrdysfhklsyltfipsdddiydckvehwgleepvlk
    hwssadlvpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mujA (A:)
    dieadhvgtygisvyqspgdigqytfefdgdelfyvdldkketvwmlpefgqlasfdpqg
    glqniavvkhnlgvltkrsnstpatneapqatvfpkspvllgqpntlicfvdnifppvin
    itwlrnsksvadgvyetsffvnrdysfhklsyltfipsdddiydckvehwgleepvlkhw
    ssadl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1mujB (B:)
    gdserhfvyqfmgecyftngtqriryvtryiynreeyvrydsdvgehravtelgrpdaey
    wnsqpeilertraeldtvcrhnyegpethtslrrleqpnvvislsrtealnhhntlvcsv
    tdfypakikvrwfrngqeetvgvsstqlirngdwtfqvlvmlemtprrgevytchvehps
    lkspitvewssaelvpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mujB (B:)
    serhfvyqfmgecyftngtqriryvtryiynreeyvrydsdvgehravtelgrpdaeywn
    sqpeilertraeldtvcrhnyegpethtslrrleqpnvvislshntlvcsvtdfypakik
    vrwfrngqeetvgvsstqlirngdwtfqvlvmlemtprrgevytchvehpslkspitvew
    ssae
    

  • Chain 'C':
    No sequence available.