PDB entry 1muh

View 1muh on RCSB PDB site
Description: crystal structure of tn5 transposase complexed with transposon end DNA
Class: transcription/DNA
Keywords: transposase, ribonuclease h-like motif, protein-DNA complex, synaptic complex, transcription/DNA complex
Deposited on 2002-09-23, released 2002-09-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.206
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tn5 Transposase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q46731 (Start-479)
      • engineered (57)
      • engineered (59)
      • engineered (375)
      • cloning artifact (480)
    Domains in SCOPe 2.07: d1muha1, d1muha2
  • Chain 'B':
    Compound: DNA transferred strand
    Species: synthetic, synthetic
  • Chain 'C':
    Compound: DNA non-transferred strand
    Species: synthetic, synthetic
  • Heterogens: MN, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1muhA (A:)
    mvtfmitsalhraadwaksvfssaalgdprrtarlvnvaaqlakysgksitissegskaa
    qegayrfirnpnvsaeairkagamqtvklaqefpellaiedttslsyrhqvaeelgklgs
    iqdksrgwwvhsvllleattfrtvgllhqewwmrpddpadadekesgkwlaaaatsrlrm
    gsmmsnviavcdreadihaylqdklahnerfvvrskhprkdvesglylydhlknqpelgg
    yqisipqkgvvdkrgkrknrparkaslslrsgritlkqgnitlnavlaeeinppkgetpl
    kwllltsepveslaqalrvidiythrwrieefhkawktgagaerqrmeepdnlermvsil
    sfvavrllqlresftppqalraqgllkeaehvesqsaetvltpdecqllgyldkgkrkrk
    ekagslqwaymaiarlggfmdskrtgiaswgalwegwealqskldgflaakdlmaqgiki
    g
    

    Sequence, based on observed residues (ATOM records): (download)
    >1muhA (A:)
    alhraadwaksvfssaalgdprrtarlvnvaaqlakysgksitissegskaaqegayrfi
    rnpnvsaeairkagamqtvklaqefpellaiedttslsyrhqvaeelgklgsiqdksrgw
    wvhsvllleattfrtvgllhqewwmrpddpadadekesgkwlaaaatsrlrmgsmmsnvi
    avcdreadihaylqdklahnerfvvrskhprkdvesglylydhlknqpelggyqisipqk
    gvvdkrgkrknrparkaslslrsgritlkqgnitlnavlaeeinppkgetplkwllltse
    pveslaqalrvidiythrwrieefhkawktgagaerqrmeepdnlermvsilsfvavrll
    qlresftpqsaetvltpdecqllgyldkgkrkrkekagslqwaymaiarlggfmdskrtg
    iaswgalwegwealqskldgflaakdlmaqgikig
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.