PDB entry 1muf

View 1muf on RCSB PDB site
Description: Structure of histone H3 K4-specific methyltransferase SET7/9
Class: transferase
Keywords: SET domain, histone lysine methyltransferase, knot, TRANSFERASE
Deposited on 2002-09-23, released 2002-11-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 2.26 Å
R-factor: 0.229
AEROSPACI score: -1.67 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: set9
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8WTS6 (0-256)
      • modified residue (58)
      • modified residue (83)
      • modified residue (92)
      • modified residue (104)
      • modified residue (161)
      • modified residue (226)
    Domains in SCOPe 2.07: d1mufa1, d1mufa2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mufA (A:)
    vlqgtyvdgelngpaqeydtdgrlifkgqykdnirhgvcwiyypdggslvgevnedgemt
    gekiayvypdertalygkfidgemiegklatlmsteegrphfelmpgnsvyhfdkstssc
    istnallpdpyeservyvaeslissageglfskvavgpntvmsfyngvrithqevdsrdw
    alngntlsldeetvidvpepynhvskycaslghkanhsftpnciydmfvhprfgpikcir
    tlraveadeeltvaygy