PDB entry 1muf

View 1muf on RCSB PDB site
Description: Structure of histone H3 K4-specific methyltransferase SET7/9
Deposited on 2002-09-23, released 2002-11-06
The last revision prior to the SCOP 1.69 freeze date was dated 2002-11-06, with a file datestamp of 2002-11-06.
Experiment type: XRAY
Resolution: 2.26 Å
R-factor: 0.229
AEROSPACI score: -1.68 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mufA (A:)
    vlqgtyvdgelngpaqeydtdgrlifkgqykdnirhgvcwiyypdggslvgevnedgemt
    gekiayvypdertalygkfidgemiegklatlmsteegrphfelmpgnsvyhfdkstssc
    istnallpdpyeservyvaeslissageglfskvavgpntvmsfyngvrithqevdsrdw
    alngntlsldeetvidvpepynhvskycaslghkanhsftpnciydmfvhprfgpikcir
    tlraveadeeltvaygy