PDB entry 1muc

View 1muc on RCSB PDB site
Description:
Deposited on 1995-09-20, released 1996-07-11
The last revision prior to the SCOP 1.71 freeze date was dated 1996-07-11, with a file datestamp of 1996-07-11.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.168
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.71: d1muca1, d1muca2
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.71: d1mucb1, d1mucb2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1mucA (A:)
    mtsalieridaiivdlptirphklamhtmqqqtlvvlrvrcsdgvegigeattigglayg
    yespegikanidahlapaliglaadninaamlkldklakgntfaksgiesalldaqgkrl
    glpvsellggrvrdslevawtlasgdtardiaearhmleirrhrvfklkiganpveqdlk
    hvvtikrelgdsasvrvdvnqywdesqairacqvlgdngidlieqpisrinrggqvrlnq
    rtpapimadesiesvedafslaadgaasifalkiaknggpravlrtaqiaeaagiglygg
    tmlegsigtlasahafltlrqltwgtelfgplllteeivneppqyrdfqlhiprtpglgl
    tldeqrlarfarr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mucA (A:)
    alieridaiivdlptirqqqtlvvlrvrcsdgvegigeattigglaygyespegikanid
    ahlapaliglaadninaamlkldklakgntfaksgiesalldaqgkrlglpvsellggrv
    rdslevawtlasgdtardiaearhmleirrhrvfklkiganpveqdlkhvvtikrelgds
    asvrvdvnqywdesqairacqvlgdngidlieqpisrinrggqvrlnqrtpapimadesi
    esvedafslaadgaasifalkiaknggpravlrtaqiaeaagiglyggtmlegsigtlas
    ahafltlrqltwgtelfgplllteeivneppqyrdfqlhiprtpglgltldeqrlarfar
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1mucB (B:)
    mtsalieridaiivdlptirphklamhtmqqqtlvvlrvrcsdgvegigeattigglayg
    yespegikanidahlapaliglaadninaamlkldklakgntfaksgiesalldaqgkrl
    glpvsellggrvrdslevawtlasgdtardiaearhmleirrhrvfklkiganpveqdlk
    hvvtikrelgdsasvrvdvnqywdesqairacqvlgdngidlieqpisrinrggqvrlnq
    rtpapimadesiesvedafslaadgaasifalkiaknggpravlrtaqiaeaagiglygg
    tmlegsigtlasahafltlrqltwgtelfgplllteeivneppqyrdfqlhiprtpglgl
    tldeqrlarfarr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mucB (B:)
    alieridaiivdlptirqqqtlvvlrvrcsdgvegigeattigglaygyespegikanid
    ahlapaliglaadninaamlkldklakgntfaksgiesalldaqgkrlglpvsellggrv
    rdslevawtlasgdtardiaearhmleirrhrvfklkiganpveqdlkhvvtikrelgds
    asvrvdvnqywdesqairacqvlgdngidlieqpisrinrggqvrlnqrtpapimadesi
    esvedafslaadgaasifalkiaknggpravlrtaqiaeaagiglyggtmlegsigtlas
    ahafltlrqltwgtelfgplllteeivneppqyrdfqlhiprtpglgltldeqrlarfar