PDB entry 1mua

View 1mua on RCSB PDB site
Description: structure and energetics of a non-proline cis-peptidyl linkage in an engineered protein
Class: lyase(oxo-acid)
Keywords: lyase(oxo-acid)
Deposited on 1993-06-18, released 1993-10-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.188
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: carbonic anhydrase II
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00918 (0-255)
      • conflict (197)
    Domains in SCOPe 2.07: d1muaa_
  • Heterogens: ZN, HG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1muaA (A:)
hwgygkhngpehwhkdfpiakgerqspvdidthtakydpslkplsvsydqatslrilnng
hafnvefddsqdkavlkggpldgtyrliqfhfhwgsldgqgsehtvdkkkyaaelhlvhw
ntkygdfgkavqqpdglavlgiflkvgsakpglqkvvdvldsiktkgksadftnfdprgl
lpesldywtypgslttpallecvtwivlkepisvsseqvlkfrklnfngegepeelmvdn
wrpaqplknrqikasf