PDB entry 1mu4

View 1mu4 on RCSB PDB site
Description: crystal structure at 1.8 angstroms of the bacillus subtilis catabolite repression histidine containing protein (crh)
Class: transport protein
Keywords: open-faced b-sandwich, phosphotransferase system, swapping domain, transport protein
Deposited on 2002-09-23, released 2003-10-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.179
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: HPr-like protein crh
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O06976 (0-84)
      • cloning artifact (85)
    Domains in SCOPe 2.07: d1mu4a1, d1mu4a2
  • Chain 'B':
    Compound: HPr-like protein crh
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O06976 (0-84)
      • cloning artifact (85-86)
    Domains in SCOPe 2.07: d1mu4b1, d1mu4b2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1mu4A (A:)
    mvqqkvevrlktglqarpaalfvqeanrftsdvflekdgkkvnaksimglmslavstgte
    vtliaqgedeqealeklaayvqeevlq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mu4A (A:)
    mvqqkvevrlktglqarpaalfvqeanrftsdvflekdgkkvnaksimglmslavstgte
    vtliaqgedeqealeklaayvqeevl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mu4B (B:)
    mvqqkvevrlktglqarpaalfvqeanrftsdvflekdgkkvnaksimglmslavstgte
    vtliaqgedeqealeklaayvqeevlq