PDB entry 1mu2

View 1mu2 on RCSB PDB site
Description: crystal structure of hiv-2 reverse transcriptase
Deposited on 2002-09-23, released 2002-10-30
The last revision prior to the SCOP 1.67 freeze date was dated 2002-10-30, with a file datestamp of 2002-10-30.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.192
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1mu2A (A:)
    pvakvepikimlkpgkdgpklrqwpltkekiealkeicekmekegqleeapptnpyntpt
    faikkkdknkwrmlidfrelnkvtqdfteiqlgiphpaglakkrritvldvgdayfsipl
    hedfrpytaftlpsvnnaepgkryiykvlpqgwkgspaifqhtmrqvlepfrkankdvii
    iqymddiliasdrtdlehdrvvlqlkellnglgfstpdekfqkdppyhwmgyelwptkwk
    lqkiqlpqkeiwtvndiqklvgvlnwaaqlypgiktkhlcrlisgkmtlteevqwtelae
    aeleenriilsqeqeghyyqeekeleatvqkdqdnqwtykihqeekilkvgkyakvknth
    tngirllaqvvqkigkealviwgripkfhlpvereiweqwwdnywqvtwipdwdfvstpp
    lvrlafnlvgdpipgaetfytdgscnrqskegkagyvtdrgkdkvkkleqttnqqaelea
    famaltdsgpkvniivdsqyvmgivasqpteseskivnqiieemikkeaiyvawvpahkg
    iggnqevdhlvsqgi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mu2A (A:)
    akvepikimlkpgkdgpklrqwpltkekiealkeicekmekegqleeapptnpyntptfa
    ikkkdrmlidfrelnkvtqdfteiqlgiphpaglakkrritvldvgdayfsiplhedfrp
    ytaftlkryiykvlpqgwkgspaifqhtmrqvlepfrkankdviiiqymddiliasdrtd
    lehdrvvlqlkellnglgfstpdekfqkdppyhwmgyelwptkwklqkiqlpqkeiwtvn
    diqklvgvlnwaaqlypgiktkhlcrlisgkmtlteevqwtelaeaeleenriilsqeqe
    ghyyqeekeleatvqkdqdnqwtykihqeekilkvgkyakvthtngirllaqvvqkigke
    alviwgripkfhlpvereiweqwwdnywqvtwipdwdfvstpplvrlafnlvgdpipgae
    tfytdgscnrqskegkagyvtdrgkdkvkkleqttnqqaeleafamaltdsgpkvniivd
    sqyvmgivasqpteseskivnqiieemikkeaiyvawvpahkgiggnqevdhlvsqgi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1mu2B (B:)
    epikimlkpgkdgpklrqwpltkekiealkeicekmekegqleeapptnpyntptfaikk
    kdknkwrmlidfrelnkvtqdfteiqlgiphpaglakkrritvldvgdayfsiplhedfr
    pytaftlpsvnnaepgkryiykvlpqgwkgspaifqhtmrqvlepfrkankdviiiqymd
    diliasdrtdlehdrvvlqlkellnglgfstpdekfqkdppyhwmgyelwptkwklqkiq
    lpqkeiwtvndiqklvgvlnwaaqlypgiktkhlcrlisgkmtlteevqwtelaeaelee
    nriilsqeqeghyyqeekeleatvqkdqdnqwtykihqeekilkvgkyakvknthtngir
    llaqvvqkigkealviwgripkfhlpvereiweqwwdnywqvtwipdwdfvstpplvrla
    fnlvgd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mu2B (B:)
    epikimlkpgkdgpklrqwpltkekiealkeicekmekegqleeapptnpyntptfaikn
    kwrmlidfrelnkvtqdfteiqphpaglakkrritvldvgdayfsiplhedfrpytaftl
    psvnnaepgkryiykvlpqgwkgspaifqhtmrqvlepfrkankdviiiqymddiliasd
    rtdlehdrvvlqlkellngwmgyelwptkwklqkiqlpqkeiwtvndiqklvgvlnwaaq
    lypgiktkhlcrlisgkmtlteevqwtelaeaeleenriilsqeqeghyyqeekeleatv
    qkdqdnqwtykihqeekilkvgkyakvknthtngirllaqvvqkigkealviwgripkfh
    lpvereiweqwwdnywqvtwipdwdfvstpplvrlafnlvgd