PDB entry 1mty

View 1mty on RCSB PDB site
Description:
Deposited on 1996-07-10, released 1997-04-21
The last revision prior to the SCOP 1.71 freeze date was dated 1997-04-21, with a file datestamp of 1997-04-22.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.183
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.71: d1mtyb_
  • Chain 'C':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.71: d1mtyc_
  • Chain 'D':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.71: d1mtyd_
  • Chain 'E':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.71: d1mtye_
  • Chain 'G':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.71: d1mtyg_
  • Chain 'H':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.71: d1mtyh_

PDB Chain Sequences:

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mtyB (B:)
    errrgltdpemaavilkalpeapldgnnkmgyfvtprwkrlteyealtvyaqpnadwiag
    gldwgdwtqkfhggrpswgnettelrtvdwfkhrdplrrwhapyvkdkaeewrytdrflq
    gysadgqiramnptwrdefinrywgaflfneyglfnahsqgarealsdvtrvslafwgfd
    kidiaqmiqlergflakivpgfdestavpkaewtngevyksarlaveglwqevfdwnesa
    fsvhavydalfgqfvrreffqrlaprfgdnltpffinqaqtyfqiakqgvqdlyynclgd
    dpefsdynrtvmrnwtgkwleptiaalrdfmglfaklpagttdkeeitaslyrvvddwie
    dyasridfkadrdqivkavlaglk
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mtyC (C:)
    errrgltdpemaavilkalpeapldgnnkmgyfvtprwkrlteyealtvyaqpnadwiag
    gldwgdwtqkfhggrpswgnettelrtvdwfkhrdplrrwhapyvkdkaeewrytdrflq
    gysadgqiramnptwrdefinrywgaflfneyglfnahsqgarealsdvtrvslafwgfd
    kidiaqmiqlergflakivpgfdestavpkaewtngevyksarlaveglwqevfdwnesa
    fsvhavydalfgqfvrreffqrlaprfgdnltpffinqaqtyfqiakqgvqdlyynclgd
    dpefsdynrtvmrnwtgkwleptiaalrdfmglfaklpagttdkeeitaslyrvvddwie
    dyasridfkadrdqivkavlaglk
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mtyD (D:)
    aanraptsvnaqevhrwlqsfnwdfknnrtkyatkykmanetkeqfkliakeyarmeavk
    derqfgslqvaltrlnagvrvhpkwnetmkvvsnflevgeynaiaatgmlwdsaqaaeqk
    ngylaqvldeirhthqcayvnyyfakngqdpaghndarrtrtigplwkgmkrvfsdgfis
    gdavecslnlqlvgeacftnplivavtewaaangdeitptvflsietdelrhmangyqtv
    vsiandpasakylntdlnnafwtqqkyftpvlgmlfeygskfkvepwvktwdrwvyedwg
    giwigrlgkygvesprslkdakqdaywahhdlyllayalwptgffrlalpdqeemewfea
    nypgwydhygkiyeewrargcedpssgfiplmwfiennhpiyidrvsqvpfcpslakgas
    tlrvheyngemhtfsdqwgermwlaeperyecqnifeqyegrelseviaelhglrsdgkt
    liaqphvrgdklwtlddikrlncvfknpvkaf
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mtyE (E:)
    aanraptsvnaqevhrwlqsfnwdfknnrtkyatkykmanetkeqfkliakeyarmeavk
    derqfgslqvaltrlnagvrvhpkwnetmkvvsnflevgeynaiaatgmlwdsaqaaeqk
    ngylaqvldeirhthqcayvnyyfakngqdpaghndarrtrtigplwkgmkrvfsdgfis
    gdavecslnlqlvgeacftnplivavtewaaangdeitptvflsietdelrhmangyqtv
    vsiandpasakylntdlnnafwtqqkyftpvlgmlfeygskfkvepwvktwdrwvyedwg
    giwigrlgkygvesprslkdakqdaywahhdlyllayalwptgffrlalpdqeemewfea
    nypgwydhygkiyeewrargcedpssgfiplmwfiennhpiyidrvsqvpfcpslakgas
    tlrvheyngemhtfsdqwgermwlaeperyecqnifeqyegrelseviaelhglrsdgkt
    liaqphvrgdklwtlddikrlncvfknpvkaf
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mtyG (G:)
    lgihsndtrdawvnkiahvntlekaaemlkqfrmdhttpfrnsyeldndylwieakleek
    vavlkarafnevdfrhktafgedaksvldgtvakmnaakdkweaekihigfrqaykppim
    pvnyfldgerqlgtrlmelrnlnyydtpleelrkqrgvrvvh
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mtyH (H:)
    lgihsndtrdawvnkiahvntlekaaemlkqfrmdhttpfrnsyeldndylwieakleek
    vavlkarafnevdfrhktafgedaksvldgtvakmnaakdkweaekihigfrqaykppim
    pvnyfldgerqlgtrlmelrnlnyydtpleelrkqrgvrvvh