PDB entry 1mtx

View 1mtx on RCSB PDB site
Description: determination of the three-dimensional structure of margatoxin by 1h, 13c, 15n triple-resonance nuclear magnetic resonance spectroscopy
Class: toxin
Keywords: toxin
Deposited on 1994-12-27, released 1995-11-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: margatoxin
  Species: Centruroides margaritatus [TaxId:29018]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P40755 (0-38)
  Domains in SCOPe 2.08: d1mtxa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1mtxA (A:)
  tiinvkctspkqclppckaqfgqsagakcmngkckcyph