PDB entry 1mtk

View 1mtk on RCSB PDB site
Description: phe46(cd4) orients the distal histidine for hydrogen bonding to bound ligands in sperm whale myoglobin
Deposited on 1994-12-12, released 1995-09-15
The last revision prior to the SCOP 1.57 freeze date was dated 1995-09-15, with a file datestamp of 1995-09-15.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.1657
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.57: d1mtk__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1mtk_ (-)
  mvlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrvkhlkteaemkase
  dlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh
  pgnfgadaqgamnkalelfrkdiaakykelgyqg