PDB entry 1mtj

View 1mtj on RCSB PDB site
Description: phe46(cd4) orients the distal histidine for hydrogen bonding to bound ligands in sperm whale myoglobin
Deposited on 1994-12-12, released 1995-09-15
The last revision prior to the SCOP 1.55 freeze date was dated 1995-09-15, with a file datestamp of 1995-09-15.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.1621
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1mtj__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mtj_ (-)
    mvlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrvkhlkteaemkase
    dlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh
    pgnfgadaqgamnkalelfrkdiaakykelgyqg