PDB entry 1mti

View 1mti on RCSB PDB site
Description: phe46(cd4) orients the distal histidine for hydrogen bonding to bound ligands in sperm whale myoglobin
Class: oxygen storage
Keywords: oxygen storage
Deposited on 1994-12-12, released 1995-09-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.176
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myoglobin
    Species: Physeter catodon [TaxId:9755]
    Gene: synthetic
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02185 (1-153)
      • conflict (46)
      • conflict (122)
    Domains in SCOPe 2.08: d1mtia_
  • Heterogens: SO4, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mtiA (A:)
    mvlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrlkhlkteaemkase
    dlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh
    pgnfgadaqgamnkalelfrkdiaakykelgyqg