PDB entry 1mti

View 1mti on RCSB PDB site
Description: phe46(cd4) orients the distal histidine for hydrogen bonding to bound ligands in sperm whale myoglobin
Class: oxygen storage
Keywords: oxygen storage
Deposited on 1994-12-12, released 1995-09-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.176
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Myoglobin
  Species: Physeter catodon [TaxId:9755]
  Gene: synthetic
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02185 (1-153)
    • conflict (46)
    • conflict (122)
  Domains in SCOPe 2.08: d1mtia_
• Heterogens: SO4, HEM, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1mtiA (A:)
  mvlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrlkhlkteaemkase
  dlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh
  pgnfgadaqgamnkalelfrkdiaakykelgyqg