PDB entry 1mtb

View 1mtb on RCSB PDB site
Description: Viability of a drug-resistant HIV-1 protease mutant: structural insights for better antiviral therapy
Class: hydrolase/hydrolase inhibitor
Keywords: HIV-1 protease, drug resistance, substrate recognition, inhibitor binding, HYDROLASE-HYDROLASE INHIBITOR COMPLEX
Deposited on 2002-09-20, released 2003-01-07
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.191
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protease retropepsin
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03369 (0-98)
      • engineered (24)
    Domains in SCOPe 2.04: d1mtba_
  • Chain 'B':
    Compound: protease retropepsin
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03369 (0-98)
      • engineered (24)
    Domains in SCOPe 2.04: d1mtbb_
  • Heterogens: QNC, DIQ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mtbA (A:)
    pqitlwqrplvtiriggqlkeallntgaddtvleemnlpgkwkpkmiggiggfikvrqyd
    qipveicghkaigtvlvgptpvniigrnlltqigctlnf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mtbB (B:)
    pqitlwqrplvtiriggqlkeallntgaddtvleemnlpgkwkpkmiggiggfikvrqyd
    qipveicghkaigtvlvgptpvniigrnlltqigctlnf