PDB entry 1mtb
View 1mtb on RCSB PDB site
Description: Viability of a drug-resistant HIV-1 protease mutant: structural insights for better antiviral therapy
Class: hydrolase/hydrolase inhibitor
Keywords: HIV-1 protease, drug resistance, substrate recognition, inhibitor binding, HYDROLASE-HYDROLASE INHIBITOR COMPLEX
Deposited on
2002-09-20, released
2003-01-07
The last revision prior to the SCOPe 2.04 freeze date was dated
2011-07-13, with a file datestamp of
2011-05-25.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.191
AEROSPACI score: 0.35
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: protease retropepsin
Species: Human immunodeficiency virus 1 [TaxId:11676]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.04: d1mtba_ - Chain 'B':
Compound: protease retropepsin
Species: Human immunodeficiency virus 1 [TaxId:11676]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.04: d1mtbb_ - Heterogens: QNC, DIQ, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1mtbA (A:)
pqitlwqrplvtiriggqlkeallntgaddtvleemnlpgkwkpkmiggiggfikvrqyd
qipveicghkaigtvlvgptpvniigrnlltqigctlnf
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1mtbB (B:)
pqitlwqrplvtiriggqlkeallntgaddtvleemnlpgkwkpkmiggiggfikvrqyd
qipveicghkaigtvlvgptpvniigrnlltqigctlnf