PDB entry 1mtb

View 1mtb on RCSB PDB site
Description: viability of a drug-resistant hiv-1 protease mutant: structural insights for better antiviral therapy
Deposited on 2002-09-20, released 2003-01-07
The last revision prior to the SCOP 1.67 freeze date was dated 2003-01-07, with a file datestamp of 2003-01-07.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.191
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1mtba_
  • Chain 'B':
    Domains in SCOP 1.67: d1mtbb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1mtbA (A:)
pqitlwqrplvtiriggqlkeallntgaddtvleemnlpgkwkpkmiggiggfikvrqyd
qipveicghkaigtvlvgptpvniigrnlltqigctlnf

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1mtbB (B:)
pqitlwqrplvtiriggqlkeallntgaddtvleemnlpgkwkpkmiggiggfikvrqyd
qipveicghkaigtvlvgptpvniigrnlltqigctlnf