PDB entry 1mt7
View 1mt7 on RCSB PDB site
Description: Viability of a drug-resistant HIV-1 protease mutant: structural insights for better antiviral therapy
Class: hydrolase/hydrolase inhibitor
Keywords: Matrix, Capsid, Gag cleavage, drug resistance, substrate recognition, HYDROLASE/HYDROLASE INHIBITOR COMPLEX
Deposited on
2002-09-20, released
2003-01-07
The last revision prior to the SCOPe 2.06 freeze date was dated
2009-02-24, with a file datestamp of
2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.201
AEROSPACI score: 0.47
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: protease retropepsin
Species: Human immunodeficiency virus 1 [TaxId:11676]
Database cross-references and differences (RAF-indexed):
- Uniprot P03369 (0-98)
- engineered (6)
- engineered (24)
- engineered (81)
Domains in SCOPe 2.06: d1mt7a_ - Chain 'B':
Compound: protease retropepsin
Species: Human immunodeficiency virus 1 [TaxId:11676]
Database cross-references and differences (RAF-indexed):
- Uniprot P03369 (0-98)
- engineered (6)
- engineered (24)
- engineered (81)
Domains in SCOPe 2.06: d1mt7b_ - Chain 'P':
Compound: MA-CA cleavage site of HIV-1 Gag polyprotein
Species: synthetic, synthetic
- Heterogens: ACT, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1mt7A (A:)
pqitlwkrplvtiriggqlkeallntgaddtvleemnlpgkwkpkmiggiggfikvrqyd
qipveicghkaigtvlvgptpaniigrnlltqigctlnf
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1mt7B (B:)
pqitlwkrplvtiriggqlkeallntgaddtvleemnlpgkwkpkmiggiggfikvrqyd
qipveicghkaigtvlvgptpaniigrnlltqigctlnf
- Chain 'P':
No sequence available.