PDB entry 1mt6

View 1mt6 on RCSB PDB site
Description: Structure of histone H3 K4-specific methyltransferase SET7/9 with AdoHcy
Class: transferase
Keywords: SET domain, histone lysine methyltransferase, AdoHcy, knot
Deposited on 2002-09-20, released 2002-11-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.226
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: set9
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1mt6a1, d1mt6a2
  • Heterogens: SAH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mt6A (A:)
    tlegyyvddalqgqgvytyedggvlqgtyvdgelngpaqeydtdgrlifkgqykdnirhg
    vcwiyypdggslvgevnedgemtgekiayvypdertalygkfidgemiegklatlmstee
    grphfelmpgnsvyhfdkstsscistnallpdpyeservyvaeslissageglfskvavg
    pntvmsfyngvrithqevdsrdwalngntlsldeetvidvpepynhvskycaslghkanh
    sftpnciydmfvhprfgpikcirtlraveadeeltvaygy