PDB entry 1mt6

View 1mt6 on RCSB PDB site
Description: Structure of histone H3 K4-specific methyltransferase SET7/9 with AdoHcy
Deposited on 2002-09-20, released 2002-11-06
The last revision prior to the SCOP 1.69 freeze date was dated 2002-11-06, with a file datestamp of 2002-11-06.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.226
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mt6A (A:)
    tlegyyvddalqgqgvytyedggvlqgtyvdgelngpaqeydtdgrlifkgqykdnirhg
    vcwiyypdggslvgevnedgemtgekiayvypdertalygkfidgemiegklatlmstee
    grphfelmpgnsvyhfdkstsscistnallpdpyeservyvaeslissageglfskvavg
    pntvmsfyngvrithqevdsrdwalngntlsldeetvidvpepynhvskycaslghkanh
    sftpnciydmfvhprfgpikcirtlraveadeeltvaygy