PDB entry 1mt5

View 1mt5 on RCSB PDB site
Description: crystal structure of fatty acid amide hydrolase
Class: hydrolase
Keywords: amidase signature, hydrolase
Deposited on 2002-09-20, released 2002-12-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.221
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fatty-acid amide hydrolase
    Species: Rattus norvegicus [TaxId:10116]
    Gene: FAAH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1mt5a_
  • Chain 'B':
    Compound: Fatty-acid amide hydrolase
    Species: Rattus norvegicus [TaxId:10116]
    Gene: FAAH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1mt5b_
  • Chain 'C':
    Compound: Fatty-acid amide hydrolase
    Species: Rattus norvegicus [TaxId:10116]
    Gene: FAAH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1mt5c_
  • Chain 'D':
    Compound: Fatty-acid amide hydrolase
    Species: Rattus norvegicus [TaxId:10116]
    Gene: FAAH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1mt5d_
  • Chain 'E':
    Compound: Fatty-acid amide hydrolase
    Species: Rattus norvegicus [TaxId:10116]
    Gene: FAAH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1mt5e_
  • Chain 'F':
    Compound: Fatty-acid amide hydrolase
    Species: Rattus norvegicus [TaxId:10116]
    Gene: FAAH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1mt5f_
  • Chain 'G':
    Compound: Fatty-acid amide hydrolase
    Species: Rattus norvegicus [TaxId:10116]
    Gene: FAAH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1mt5g_
  • Chain 'H':
    Compound: Fatty-acid amide hydrolase
    Species: Rattus norvegicus [TaxId:10116]
    Gene: FAAH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1mt5h_
  • Chain 'I':
    Compound: Fatty-acid amide hydrolase
    Species: Rattus norvegicus [TaxId:10116]
    Gene: FAAH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1mt5i_
  • Chain 'J':
    Compound: Fatty-acid amide hydrolase
    Species: Rattus norvegicus [TaxId:10116]
    Gene: FAAH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1mt5j_
  • Chain 'K':
    Compound: Fatty-acid amide hydrolase
    Species: Rattus norvegicus [TaxId:10116]
    Gene: FAAH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1mt5k_
  • Chain 'L':
    Compound: Fatty-acid amide hydrolase
    Species: Rattus norvegicus [TaxId:10116]
    Gene: FAAH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1mt5l_
  • Chain 'M':
    Compound: Fatty-acid amide hydrolase
    Species: Rattus norvegicus [TaxId:10116]
    Gene: FAAH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1mt5m_
  • Chain 'N':
    Compound: Fatty-acid amide hydrolase
    Species: Rattus norvegicus [TaxId:10116]
    Gene: FAAH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1mt5n_
  • Chain 'O':
    Compound: Fatty-acid amide hydrolase
    Species: Rattus norvegicus [TaxId:10116]
    Gene: FAAH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1mt5o_
  • Chain 'P':
    Compound: Fatty-acid amide hydrolase
    Species: Rattus norvegicus [TaxId:10116]
    Gene: FAAH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1mt5p_
  • Heterogens: MAY

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mt5A (A:)
    argaatrarqkqrasletmdkavqrfrlqnpdldsealltlpllqlvqklqsgelspeav
    fftylgkawevnkgtncvtsyltdcetqlsqaprqgllygvpvslkecfsykghdstlgl
    slnegmpsesdcvvvqvlklqgavpfvhtnvpqsmlsfdcsnplfgqtmnpwksskspgg
    ssggegaligsggsplglgtdiggsirfpsafcgicglkptgnrlsksglkgcvygqtav
    qlslgpmardveslalclkallcehlftldptvpplpfreevyrssrplrvgyyetdnyt
    mpspamrralietkqrleaaghtlipflpnnipyalevlsagglfsdggrsflqnfkgdf
    vdpclgdlililrlpswfkrllslllkplfprlaaflnsmrprsaeklwklqheiemyrq
    sviaqwkamnldvlltpmlgpaldlntpgratgaisytvlyncldfpagvvpvttvtaed
    daqmelykgyfgdiwdiilkkamknsvglpvavqcvalpwqeelclrfmreveqlmt
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mt5B (B:)
    argaatrarqkqrasletmdkavqrfrlqnpdldsealltlpllqlvqklqsgelspeav
    fftylgkawevnkgtncvtsyltdcetqlsqaprqgllygvpvslkecfsykghdstlgl
    slnegmpsesdcvvvqvlklqgavpfvhtnvpqsmlsfdcsnplfgqtmnpwksskspgg
    ssggegaligsggsplglgtdiggsirfpsafcgicglkptgnrlsksglkgcvygqtav
    qlslgpmardveslalclkallcehlftldptvpplpfreevyrssrplrvgyyetdnyt
    mpspamrralietkqrleaaghtlipflpnnipyalevlsagglfsdggrsflqnfkgdf
    vdpclgdlililrlpswfkrllslllkplfprlaaflnsmrprsaeklwklqheiemyrq
    sviaqwkamnldvlltpmlgpaldlntpgratgaisytvlyncldfpagvvpvttvtaed
    daqmelykgyfgdiwdiilkkamknsvglpvavqcvalpwqeelclrfmreveqlmt
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mt5C (C:)
    argaatrarqkqrasletmdkavqrfrlqnpdldsealltlpllqlvqklqsgelspeav
    fftylgkawevnkgtncvtsyltdcetqlsqaprqgllygvpvslkecfsykghdstlgl
    slnegmpsesdcvvvqvlklqgavpfvhtnvpqsmlsfdcsnplfgqtmnpwksskspgg
    ssggegaligsggsplglgtdiggsirfpsafcgicglkptgnrlsksglkgcvygqtav
    qlslgpmardveslalclkallcehlftldptvpplpfreevyrssrplrvgyyetdnyt
    mpspamrralietkqrleaaghtlipflpnnipyalevlsagglfsdggrsflqnfkgdf
    vdpclgdlililrlpswfkrllslllkplfprlaaflnsmrprsaeklwklqheiemyrq
    sviaqwkamnldvlltpmlgpaldlntpgratgaisytvlyncldfpagvvpvttvtaed
    daqmelykgyfgdiwdiilkkamknsvglpvavqcvalpwqeelclrfmreveqlmt
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mt5D (D:)
    argaatrarqkqrasletmdkavqrfrlqnpdldsealltlpllqlvqklqsgelspeav
    fftylgkawevnkgtncvtsyltdcetqlsqaprqgllygvpvslkecfsykghdstlgl
    slnegmpsesdcvvvqvlklqgavpfvhtnvpqsmlsfdcsnplfgqtmnpwksskspgg
    ssggegaligsggsplglgtdiggsirfpsafcgicglkptgnrlsksglkgcvygqtav
    qlslgpmardveslalclkallcehlftldptvpplpfreevyrssrplrvgyyetdnyt
    mpspamrralietkqrleaaghtlipflpnnipyalevlsagglfsdggrsflqnfkgdf
    vdpclgdlililrlpswfkrllslllkplfprlaaflnsmrprsaeklwklqheiemyrq
    sviaqwkamnldvlltpmlgpaldlntpgratgaisytvlyncldfpagvvpvttvtaed
    daqmelykgyfgdiwdiilkkamknsvglpvavqcvalpwqeelclrfmreveqlmt
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mt5E (E:)
    argaatrarqkqrasletmdkavqrfrlqnpdldsealltlpllqlvqklqsgelspeav
    fftylgkawevnkgtncvtsyltdcetqlsqaprqgllygvpvslkecfsykghdstlgl
    slnegmpsesdcvvvqvlklqgavpfvhtnvpqsmlsfdcsnplfgqtmnpwksskspgg
    ssggegaligsggsplglgtdiggsirfpsafcgicglkptgnrlsksglkgcvygqtav
    qlslgpmardveslalclkallcehlftldptvpplpfreevyrssrplrvgyyetdnyt
    mpspamrralietkqrleaaghtlipflpnnipyalevlsagglfsdggrsflqnfkgdf
    vdpclgdlililrlpswfkrllslllkplfprlaaflnsmrprsaeklwklqheiemyrq
    sviaqwkamnldvlltpmlgpaldlntpgratgaisytvlyncldfpagvvpvttvtaed
    daqmelykgyfgdiwdiilkkamknsvglpvavqcvalpwqeelclrfmreveqlmt
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mt5F (F:)
    argaatrarqkqrasletmdkavqrfrlqnpdldsealltlpllqlvqklqsgelspeav
    fftylgkawevnkgtncvtsyltdcetqlsqaprqgllygvpvslkecfsykghdstlgl
    slnegmpsesdcvvvqvlklqgavpfvhtnvpqsmlsfdcsnplfgqtmnpwksskspgg
    ssggegaligsggsplglgtdiggsirfpsafcgicglkptgnrlsksglkgcvygqtav
    qlslgpmardveslalclkallcehlftldptvpplpfreevyrssrplrvgyyetdnyt
    mpspamrralietkqrleaaghtlipflpnnipyalevlsagglfsdggrsflqnfkgdf
    vdpclgdlililrlpswfkrllslllkplfprlaaflnsmrprsaeklwklqheiemyrq
    sviaqwkamnldvlltpmlgpaldlntpgratgaisytvlyncldfpagvvpvttvtaed
    daqmelykgyfgdiwdiilkkamknsvglpvavqcvalpwqeelclrfmreveqlmt
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mt5G (G:)
    argaatrarqkqrasletmdkavqrfrlqnpdldsealltlpllqlvqklqsgelspeav
    fftylgkawevnkgtncvtsyltdcetqlsqaprqgllygvpvslkecfsykghdstlgl
    slnegmpsesdcvvvqvlklqgavpfvhtnvpqsmlsfdcsnplfgqtmnpwksskspgg
    ssggegaligsggsplglgtdiggsirfpsafcgicglkptgnrlsksglkgcvygqtav
    qlslgpmardveslalclkallcehlftldptvpplpfreevyrssrplrvgyyetdnyt
    mpspamrralietkqrleaaghtlipflpnnipyalevlsagglfsdggrsflqnfkgdf
    vdpclgdlililrlpswfkrllslllkplfprlaaflnsmrprsaeklwklqheiemyrq
    sviaqwkamnldvlltpmlgpaldlntpgratgaisytvlyncldfpagvvpvttvtaed
    daqmelykgyfgdiwdiilkkamknsvglpvavqcvalpwqeelclrfmreveqlmt
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mt5H (H:)
    argaatrarqkqrasletmdkavqrfrlqnpdldsealltlpllqlvqklqsgelspeav
    fftylgkawevnkgtncvtsyltdcetqlsqaprqgllygvpvslkecfsykghdstlgl
    slnegmpsesdcvvvqvlklqgavpfvhtnvpqsmlsfdcsnplfgqtmnpwksskspgg
    ssggegaligsggsplglgtdiggsirfpsafcgicglkptgnrlsksglkgcvygqtav
    qlslgpmardveslalclkallcehlftldptvpplpfreevyrssrplrvgyyetdnyt
    mpspamrralietkqrleaaghtlipflpnnipyalevlsagglfsdggrsflqnfkgdf
    vdpclgdlililrlpswfkrllslllkplfprlaaflnsmrprsaeklwklqheiemyrq
    sviaqwkamnldvlltpmlgpaldlntpgratgaisytvlyncldfpagvvpvttvtaed
    daqmelykgyfgdiwdiilkkamknsvglpvavqcvalpwqeelclrfmreveqlmt
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mt5I (I:)
    argaatrarqkqrasletmdkavqrfrlqnpdldsealltlpllqlvqklqsgelspeav
    fftylgkawevnkgtncvtsyltdcetqlsqaprqgllygvpvslkecfsykghdstlgl
    slnegmpsesdcvvvqvlklqgavpfvhtnvpqsmlsfdcsnplfgqtmnpwksskspgg
    ssggegaligsggsplglgtdiggsirfpsafcgicglkptgnrlsksglkgcvygqtav
    qlslgpmardveslalclkallcehlftldptvpplpfreevyrssrplrvgyyetdnyt
    mpspamrralietkqrleaaghtlipflpnnipyalevlsagglfsdggrsflqnfkgdf
    vdpclgdlililrlpswfkrllslllkplfprlaaflnsmrprsaeklwklqheiemyrq
    sviaqwkamnldvlltpmlgpaldlntpgratgaisytvlyncldfpagvvpvttvtaed
    daqmelykgyfgdiwdiilkkamknsvglpvavqcvalpwqeelclrfmreveqlmt
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mt5J (J:)
    argaatrarqkqrasletmdkavqrfrlqnpdldsealltlpllqlvqklqsgelspeav
    fftylgkawevnkgtncvtsyltdcetqlsqaprqgllygvpvslkecfsykghdstlgl
    slnegmpsesdcvvvqvlklqgavpfvhtnvpqsmlsfdcsnplfgqtmnpwksskspgg
    ssggegaligsggsplglgtdiggsirfpsafcgicglkptgnrlsksglkgcvygqtav
    qlslgpmardveslalclkallcehlftldptvpplpfreevyrssrplrvgyyetdnyt
    mpspamrralietkqrleaaghtlipflpnnipyalevlsagglfsdggrsflqnfkgdf
    vdpclgdlililrlpswfkrllslllkplfprlaaflnsmrprsaeklwklqheiemyrq
    sviaqwkamnldvlltpmlgpaldlntpgratgaisytvlyncldfpagvvpvttvtaed
    daqmelykgyfgdiwdiilkkamknsvglpvavqcvalpwqeelclrfmreveqlmt
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mt5K (K:)
    argaatrarqkqrasletmdkavqrfrlqnpdldsealltlpllqlvqklqsgelspeav
    fftylgkawevnkgtncvtsyltdcetqlsqaprqgllygvpvslkecfsykghdstlgl
    slnegmpsesdcvvvqvlklqgavpfvhtnvpqsmlsfdcsnplfgqtmnpwksskspgg
    ssggegaligsggsplglgtdiggsirfpsafcgicglkptgnrlsksglkgcvygqtav
    qlslgpmardveslalclkallcehlftldptvpplpfreevyrssrplrvgyyetdnyt
    mpspamrralietkqrleaaghtlipflpnnipyalevlsagglfsdggrsflqnfkgdf
    vdpclgdlililrlpswfkrllslllkplfprlaaflnsmrprsaeklwklqheiemyrq
    sviaqwkamnldvlltpmlgpaldlntpgratgaisytvlyncldfpagvvpvttvtaed
    daqmelykgyfgdiwdiilkkamknsvglpvavqcvalpwqeelclrfmreveqlmt
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mt5L (L:)
    argaatrarqkqrasletmdkavqrfrlqnpdldsealltlpllqlvqklqsgelspeav
    fftylgkawevnkgtncvtsyltdcetqlsqaprqgllygvpvslkecfsykghdstlgl
    slnegmpsesdcvvvqvlklqgavpfvhtnvpqsmlsfdcsnplfgqtmnpwksskspgg
    ssggegaligsggsplglgtdiggsirfpsafcgicglkptgnrlsksglkgcvygqtav
    qlslgpmardveslalclkallcehlftldptvpplpfreevyrssrplrvgyyetdnyt
    mpspamrralietkqrleaaghtlipflpnnipyalevlsagglfsdggrsflqnfkgdf
    vdpclgdlililrlpswfkrllslllkplfprlaaflnsmrprsaeklwklqheiemyrq
    sviaqwkamnldvlltpmlgpaldlntpgratgaisytvlyncldfpagvvpvttvtaed
    daqmelykgyfgdiwdiilkkamknsvglpvavqcvalpwqeelclrfmreveqlmt
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mt5M (M:)
    argaatrarqkqrasletmdkavqrfrlqnpdldsealltlpllqlvqklqsgelspeav
    fftylgkawevnkgtncvtsyltdcetqlsqaprqgllygvpvslkecfsykghdstlgl
    slnegmpsesdcvvvqvlklqgavpfvhtnvpqsmlsfdcsnplfgqtmnpwksskspgg
    ssggegaligsggsplglgtdiggsirfpsafcgicglkptgnrlsksglkgcvygqtav
    qlslgpmardveslalclkallcehlftldptvpplpfreevyrssrplrvgyyetdnyt
    mpspamrralietkqrleaaghtlipflpnnipyalevlsagglfsdggrsflqnfkgdf
    vdpclgdlililrlpswfkrllslllkplfprlaaflnsmrprsaeklwklqheiemyrq
    sviaqwkamnldvlltpmlgpaldlntpgratgaisytvlyncldfpagvvpvttvtaed
    daqmelykgyfgdiwdiilkkamknsvglpvavqcvalpwqeelclrfmreveqlmt
    

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mt5N (N:)
    argaatrarqkqrasletmdkavqrfrlqnpdldsealltlpllqlvqklqsgelspeav
    fftylgkawevnkgtncvtsyltdcetqlsqaprqgllygvpvslkecfsykghdstlgl
    slnegmpsesdcvvvqvlklqgavpfvhtnvpqsmlsfdcsnplfgqtmnpwksskspgg
    ssggegaligsggsplglgtdiggsirfpsafcgicglkptgnrlsksglkgcvygqtav
    qlslgpmardveslalclkallcehlftldptvpplpfreevyrssrplrvgyyetdnyt
    mpspamrralietkqrleaaghtlipflpnnipyalevlsagglfsdggrsflqnfkgdf
    vdpclgdlililrlpswfkrllslllkplfprlaaflnsmrprsaeklwklqheiemyrq
    sviaqwkamnldvlltpmlgpaldlntpgratgaisytvlyncldfpagvvpvttvtaed
    daqmelykgyfgdiwdiilkkamknsvglpvavqcvalpwqeelclrfmreveqlmt
    

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mt5O (O:)
    argaatrarqkqrasletmdkavqrfrlqnpdldsealltlpllqlvqklqsgelspeav
    fftylgkawevnkgtncvtsyltdcetqlsqaprqgllygvpvslkecfsykghdstlgl
    slnegmpsesdcvvvqvlklqgavpfvhtnvpqsmlsfdcsnplfgqtmnpwksskspgg
    ssggegaligsggsplglgtdiggsirfpsafcgicglkptgnrlsksglkgcvygqtav
    qlslgpmardveslalclkallcehlftldptvpplpfreevyrssrplrvgyyetdnyt
    mpspamrralietkqrleaaghtlipflpnnipyalevlsagglfsdggrsflqnfkgdf
    vdpclgdlililrlpswfkrllslllkplfprlaaflnsmrprsaeklwklqheiemyrq
    sviaqwkamnldvlltpmlgpaldlntpgratgaisytvlyncldfpagvvpvttvtaed
    daqmelykgyfgdiwdiilkkamknsvglpvavqcvalpwqeelclrfmreveqlmt
    

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mt5P (P:)
    argaatrarqkqrasletmdkavqrfrlqnpdldsealltlpllqlvqklqsgelspeav
    fftylgkawevnkgtncvtsyltdcetqlsqaprqgllygvpvslkecfsykghdstlgl
    slnegmpsesdcvvvqvlklqgavpfvhtnvpqsmlsfdcsnplfgqtmnpwksskspgg
    ssggegaligsggsplglgtdiggsirfpsafcgicglkptgnrlsksglkgcvygqtav
    qlslgpmardveslalclkallcehlftldptvpplpfreevyrssrplrvgyyetdnyt
    mpspamrralietkqrleaaghtlipflpnnipyalevlsagglfsdggrsflqnfkgdf
    vdpclgdlililrlpswfkrllslllkplfprlaaflnsmrprsaeklwklqheiemyrq
    sviaqwkamnldvlltpmlgpaldlntpgratgaisytvlyncldfpagvvpvttvtaed
    daqmelykgyfgdiwdiilkkamknsvglpvavqcvalpwqeelclrfmreveqlmt