PDB entry 1mss

View 1mss on RCSB PDB site
Description: large scale structural rearrangements of the front loops in monomerised triosephosphate isomerase, as deduced from the comparison of the structural properties of monotim and its point mutation variant monoss
Class: isomerase(intramolecular oxidoreductase)
Keywords: isomerase(intramolecular oxidoreductase)
Deposited on 1994-07-27, released 1994-09-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.198
AEROSPACI score: -1.69 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: triosephosphate isomerase
    Species: Trypanosoma brucei brucei [TaxId:5702]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04789 (Start-242)
      • engineered (44-45)
      • engineered (67-71)
      • engineered (73-74)
    Domains in SCOPe 2.07: d1mssa_
  • Chain 'B':
    Compound: triosephosphate isomerase
    Species: Trypanosoma brucei brucei [TaxId:5702]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04789 (Start-242)
      • engineered (44-45)
      • engineered (67-71)
      • engineered (73-74)
    Domains in SCOPe 2.07: d1mssb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1mssA (A:)
    mskpqpiaaanwkcngsqqslselidlfnstsinhdvqcvvastsshlamtkerlshpkf
    viaaqnagnadalaslkdfgvnwivlghserrayygetneivadkvaaavasgfmviaci
    getlqeresgrtavvvltqiaaiakklkkadwakvviayepvwaigtgkvatpqqaqeah
    alirswvsskigadvagelrilyggsvngknartlyqqrdvngflvggaslkpefvdiik
    atq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mssA (A:)
    skpqpiaaanwkcngsqqslselidlfnstsinhdvqcvvastsshlamtkerlshpkfv
    iaaqnagnadalaslkdfgvnwivlghserrayygetneivadkvaaavasgfmviacig
    etlqeresgrtavvvltqiaaiakklkkadwakvviayepvwaigtgkvatpqqaqeaha
    lirswvsskigadvagelrilyggsvngknartlyqqrdvngflvggaslkpefvdiika
    tq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1mssB (B:)
    mskpqpiaaanwkcngsqqslselidlfnstsinhdvqcvvastsshlamtkerlshpkf
    viaaqnagnadalaslkdfgvnwivlghserrayygetneivadkvaaavasgfmviaci
    getlqeresgrtavvvltqiaaiakklkkadwakvviayepvwaigtgkvatpqqaqeah
    alirswvsskigadvagelrilyggsvngknartlyqqrdvngflvggaslkpefvdiik
    atq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mssB (B:)
    skpqpiaaanwkcngsqqslselidlfnstsinhdvqcvvastsshlamtkerlshpkfv
    iaaqnagnadalaslkdfgvnwivlghserrayygetneivadkvaaavasgfmviacig
    etlqeresgrtavvvltqiaaiakklkkadwakvviayepvwaigtgkvatpqqaqeaha
    lirswvsskigadvagelrilyggsvngknartlyqqrdvngflvggaslkpefvdiika
    tq