PDB entry 1msp

View 1msp on RCSB PDB site
Description: major sperm protein, alpha isoform (recombinant), ph 4.6
Deposited on 1996-05-20, released 1996-12-07
The last revision prior to the SCOP 1.55 freeze date was dated 1996-12-07, with a file datestamp of 1996-12-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.195
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1mspa_
  • Chain 'B':
    Domains in SCOP 1.55: d1mspb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mspA (A:)
    svppgdintqpsqkivfnapyddkhtyhikitnaggrrigwaikttnmrrlsvdppcgvl
    dpkekvlmavscdtfnaatedlnndritiewtntpdgaakqfrrewfqgdgmvrrknlpi
    eynl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mspB (B:)
    ppgdintqpsqkivfnapyddkhtyhikitnaggrrigwaikttnmrrlsvdppcgvldp
    kekvlmavscdtfnaatedlnndritiewtntpdgaakqfrrewfqgdgmvrrknlpiey
    nl