PDB entry 1msp

View 1msp on RCSB PDB site
Description: major sperm protein, alpha isoform (recombinant), ph 4.6
Class: cell motility protein
Keywords: cytoskeletal protein, sperm, cell motility protein
Deposited on 1996-05-20, released 1996-12-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.195
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: major sperm protein
    Species: Ascaris suum [TaxId:6253]
    Gene: ALPHA MSP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1mspa_
  • Chain 'B':
    Compound: major sperm protein
    Species: Ascaris suum [TaxId:6253]
    Gene: ALPHA MSP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1mspb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1mspA (A:)
    aqsvppgdintqpsqkivfnapyddkhtyhikitnaggrrigwaikttnmrrlsvdppcg
    vldpkekvlmavscdtfnaatedlnndritiewtntpdgaakqfrrewfqgdgmvrrknl
    pieynl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mspA (A:)
    svppgdintqpsqkivfnapyddkhtyhikitnaggrrigwaikttnmrrlsvdppcgvl
    dpkekvlmavscdtfnaatedlnndritiewtntpdgaakqfrrewfqgdgmvrrknlpi
    eynl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1mspB (B:)
    aqsvppgdintqpsqkivfnapyddkhtyhikitnaggrrigwaikttnmrrlsvdppcg
    vldpkekvlmavscdtfnaatedlnndritiewtntpdgaakqfrrewfqgdgmvrrknl
    pieynl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mspB (B:)
    ppgdintqpsqkivfnapyddkhtyhikitnaggrrigwaikttnmrrlsvdppcgvldp
    kekvlmavscdtfnaatedlnndritiewtntpdgaakqfrrewfqgdgmvrrknlpiey
    nl