PDB entry 1msl

View 1msl on RCSB PDB site
Description: structure of the mscl homologue from mycobacterium tuberculosis: a gated mechanosensitive channel.
Deposited on 1998-11-27, released 1998-12-30
The last revision prior to the SCOP 1.71 freeze date was dated 1999-04-23, with a file datestamp of 1999-04-22.
Experiment type: XRAY
Resolution: 3.5 Å
R-factor: 0.26
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1msla_
  • Chain 'B':
    Domains in SCOP 1.71: d1mslb_
  • Chain 'C':
    Domains in SCOP 1.71: d1mslc_
  • Chain 'D':
    Domains in SCOP 1.71: d1msld_
  • Chain 'E':
    Domains in SCOP 1.71: d1msle_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mslA (A:)
    argnivdlavavvigtaftalvtkftdsiitplinrigvnaqsdvgilrigigggqtidl
    nvllsaainffliafavyflvvlpyntlrkkgeveqpgdtqvvllteir
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mslB (B:)
    argnivdlavavvigtaftalvtkftdsiitplinrigvnaqsdvgilrigigggqtidl
    nvllsaainffliafavyflvvlpyntlrkkgeveqpgdtqvvllteir
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mslC (C:)
    argnivdlavavvigtaftalvtkftdsiitplinrigvnaqsdvgilrigigggqtidl
    nvllsaainffliafavyflvvlpyntlrkkgeveqpgdtqvvllteir
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mslD (D:)
    argnivdlavavvigtaftalvtkftdsiitplinrigvnaqsdvgilrigigggqtidl
    nvllsaainffliafavyflvvlpyntlrkkgeveqpgdtqvvllteir
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mslE (E:)
    argnivdlavavvigtaftalvtkftdsiitplinrigvnaqsdvgilrigigggqtidl
    nvllsaainffliafavyflvvlpyntlrkkgeveqpgdtqvvllteir