PDB entry 1mse

View 1mse on RCSB PDB site
Description: solution structure of a specific dna complex of the myb dna-binding domain with cooperative recognition helices
Deposited on 1995-01-24, released 1995-03-31
The last revision prior to the SCOP 1.65 freeze date was dated 1995-03-31, with a file datestamp of 1995-03-26.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.08 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'C':
  Domains in SCOP 1.65: d1msec1, d1msec2

PDB Chain Sequences:

• Chain 'C':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1mseC (C:)
  mlikgpwtkeedqrviklvqkygpkrwsviakhlkgrigkqcrerwhnhlnpevkktswt
  eeedriiyqahkrlgnrwaeiakllpgrtdnaiknhwnstmrrkv