PDB entry 1msc

View 1msc on RCSB PDB site
Description: crystal structure of ms2 coat protein dimer
Deposited on 1995-04-28, released 1995-07-10
The last revision prior to the SCOP 1.65 freeze date was dated 1995-07-10, with a file datestamp of 1995-07-11.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.2
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.65: d1msc__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1msc_ (-)
    asnftqfvlvdnggtgdvtvapsnfangvaewissnsrsqaykvtcsvrqssaqnrkyti
    kvevpkvatqtvggvelpvaarrsylnmeltipifatnsdcelivkamqgllkdgnpips
    aiaansgiy