PDB entry 1msb

View 1msb on RCSB PDB site
Description: structure of the calcium-dependent lectin domain from a rat mannose-binding protein determined by mad phasing
Class: hepatic lectin
Keywords: hepatic lectin
Deposited on 1991-09-23, released 1992-01-15
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.176
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: mannose-binding protein-a
    Species: Rattus rattus [TaxId:10117]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1msba_
  • Chain 'B':
    Compound: mannose-binding protein-a
    Species: Rattus rattus [TaxId:10117]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1msbb_
  • Heterogens: HO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1msbA (A:)
sgkkffvtnhermpfskvkalcselrgtvaiprnaeenkaiqevaktsaflgitdevteg
qfmyvtggrltysnwkkdepndhgsgedcvtivdnglwndiscqashtavcefpa

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1msbB (B:)
sgkkffvtnhermpfskvkalcselrgtvaiprnaeenkaiqevaktsaflgitdevteg
qfmyvtggrltysnwkkdepndhgsgedcvtivdnglwndiscqashtavcefpa