PDB entry 1ms9

View 1ms9 on RCSB PDB site
Description: triclinic form of trypanosoma cruzi trans-sialidase, in complex with lactose
Deposited on 2002-09-19, released 2003-03-25
The last revision prior to the SCOP 1.67 freeze date was dated 2003-03-25, with a file datestamp of 2003-03-25.
Experiment type: XRAY
Resolution: 1.58 Å
R-factor: 0.166
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ms9A (A:)
    mggshhhhhhgmaslapgssrvelfkrqsskvpfekdgkvtervvhsfrlpalvnvdgvm
    vaiadaryetsfdnslidtvakysvddgetwetqiaiknsrassvsrvvdptvivkgnkl
    yvlvgsynssrsywtshgdardwdillavgevtkstaggkitasikwgspvslkeffpae
    megmhtnqflggagvaivasngnlvypvqvtnkkkqvfskifysedegktwkfgkgrsaf
    gcsepvalewegkliintrvdyrrrlvyessdmgntwleavgtlsrvwgpspksnqpgsq
    ssftavtiegmrvmlfthplnfkgrwlrdrlnlwltdnqriynvgqvsigdensayssvl
    ykddklyclheinsnevyslvfarlvgelriiksvlqswknwdshlssictpadpaasss
    ergcgpavttvglvgflshsatktewedayrcvnastanaervpnglkfagvgggalwpv
    sqqgqnqryhfanhaftlvasvtihevpkgaspllgasldssggkkllglsydkrhqwqp
    iygstpvtptgswemgkryhvvltmankigsvyidgeplegsgqtvvpdertpdishfyv
    ggykrsgmptdsrvtvnnvllynrqlnaeeirtlflsqdligteahmd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ms9A (A:)
    apgssrvelfkrqsskvpfekdgkvtervvhsfrlpalvnvdgvmvaiadaryetsfdns
    lidtvakysvddgetwetqiaiknsrassvsrvvdptvivkgnklyvlvgsynssrsywt
    shgdardwdillavgevtkstaggkitasikwgspvslkeffpaemegmhtnqflggagv
    aivasngnlvypvqvtnkkkqvfskifysedegktwkfgkgrsafgcsepvalewegkli
    intrvdyrrrlvyessdmgntwleavgtlsrvwgpspksnqpgsqssftavtiegmrvml
    fthplnfkgrwlrdrlnlwltdnqriynvgqvsigdensayssvlykddklyclheinsn
    evyslvfarlvgelriiksvlqswknwdshlssictpagcgpavttvglvgflshsatkt
    ewedayrcvnastanaervpnglkfagvgggalwpvsqqgqnqryhfanhaftlvasvti
    hevpkgaspllgasldssggkkllglsydkrhqwqpiygstpvtptgswemgkryhvvlt
    mankigsvyidgeplegsgqtvvpdertpdishfyvggykrsgmptdsrvtvnnvllynr
    qlnaeeirtlflsqdligteah
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ms9B (B:)
    mggshhhhhhgmaslapgssrvelfkrqsskvpfekdgkvtervvhsfrlpalvnvdgvm
    vaiadaryetsfdnslidtvakysvddgetwetqiaiknsrassvsrvvdptvivkgnkl
    yvlvgsynssrsywtshgdardwdillavgevtkstaggkitasikwgspvslkeffpae
    megmhtnqflggagvaivasngnlvypvqvtnkkkqvfskifysedegktwkfgkgrsaf
    gcsepvalewegkliintrvdyrrrlvyessdmgntwleavgtlsrvwgpspksnqpgsq
    ssftavtiegmrvmlfthplnfkgrwlrdrlnlwltdnqriynvgqvsigdensayssvl
    ykddklyclheinsnevyslvfarlvgelriiksvlqswknwdshlssictpadpaasss
    ergcgpavttvglvgflshsatktewedayrcvnastanaervpnglkfagvgggalwpv
    sqqgqnqryhfanhaftlvasvtihevpkgaspllgasldssggkkllglsydkrhqwqp
    iygstpvtptgswemgkryhvvltmankigsvyidgeplegsgqtvvpdertpdishfyv
    ggykrsgmptdsrvtvnnvllynrqlnaeeirtlflsqdligteahmd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ms9B (B:)
    apgssrvelfkrqsskvpfekdgkvtervvhsfrlpalvnvdgvmvaiadaryetsfdns
    lidtvakysvddgetwetqiaiknsrassvsrvvdptvivkgnklyvlvgsynssrsywt
    shgdardwdillavgevtkstaggkitasikwgspvslkeffpaemegmhtnqflggagv
    aivasngnlvypvqvtnkkkqvfskifysedegktwkfgkgrsafgcsepvalewegkli
    intrvdyrrrlvyessdmgntwleavgtlsrvwgpspksnqpgsqssftavtiegmrvml
    fthplnfkgrwlrdrlnlwltdnqriynvgqvsigdensayssvlykddklyclheinsn
    evyslvfarlvgelriiksvlqswknwdshlssictpagcgpavttvglvgflshsatkt
    ewedayrcvnastanaervpnglkfagvgggalwpvsqqgqnqryhfanhaftlvasvti
    hevpkgaspllgasldssggkkllglsydkrhqwqpiygstpvtptgswemgkryhvvlt
    mankigsvyidgeplegsgqtvvpdertpdishfyvggykrsgmptdsrvtvnnvllynr
    qlnaeeirtlflsqdligteahm