PDB entry 1ms6

View 1ms6 on RCSB PDB site
Description: Dipeptide Nitrile Inhibitor Bound to Cathepsin S.
Class: hydrolase
Keywords: hydrolase, cathepsin, protease
Deposited on 2002-09-19, released 2003-04-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.155
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cathepsin S
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1ms6a_
  • Heterogens: BLN

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ms6A (A:)
    lpdsvdwrekgcvtevkyqgscgacwafsavgaleaqlklktgklvslsaqnlvdcstek
    ygnkgcnggfmttafqyiidnkgidsdasypykamdqkcqydskyraatcskytelpygr
    edvlkeavankgpvsvgvdarhpsfflyrsgvyyepsctqnvnhgvlvvgygdlngkeyw
    lvknswghnfgeegyirmarnkgnhcgiasfpsypeihhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ms6A (A:)
    lpdsvdwrekgcvtevkyqgscgacwafsavgaleaqlklktgklvslsaqnlvdcstek
    ygnkgcnggfmttafqyiidnkgidsdasypykamdqkcqydskyraatcskytelpygr
    edvlkeavankgpvsvgvdarhpsfflyrsgvyyepsctqnvnhgvlvvgygdlngkeyw
    lvknswghnfgeegyirmarnkgnhcgiasfpsypei