PDB entry 1ms1

View 1ms1 on RCSB PDB site
Description: Monoclinic form of Trypanosoma cruzi trans-sialidase, in complex with 3-deoxy-2,3-dehydro-N-acetylneuraminic acid (DANA)
Class: hydrolase
Keywords: transglycosylation, beta-propeller, protein-carbohydrate interactions, sialidase, hydrolase
Deposited on 2002-09-19, released 2003-03-25
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.177
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Trans-sialidase
    Species: Trypanosoma cruzi [TaxId:5693]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q26964 (14-End)
      • engineered (71)
      • see remark 999 (275)
      • see remark 999 (489)
      • see remark 999 (497)
      • engineered (508-509)
      • engineered (533)
      • see remark 999 (571)
      • engineered (606)
      • engineered (610)
      • engineered (612)
    Domains in SCOPe 2.06: d1ms1a1, d1ms1a2
  • Chain 'B':
    Compound: Trans-sialidase
    Species: Trypanosoma cruzi [TaxId:5693]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q26964 (14-End)
      • engineered (71)
      • see remark 999 (275)
      • see remark 999 (489)
      • see remark 999 (497)
      • engineered (508-509)
      • engineered (533)
      • see remark 999 (571)
      • engineered (606)
      • engineered (610)
      • engineered (612)
    Domains in SCOPe 2.06: d1ms1b1, d1ms1b2
  • Heterogens: DAN, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ms1A (A:)
    mggshhhhhhgmaslapgssrvelfkrqsskvpfekdgkvtervvhsfrlpalvnvdgvm
    vaiadaryetsfdnslidtvakysvddgetwetqiaiknsrassvsrvvdptvivkgnkl
    yvlvgsynssrsywtshgdardwdillavgevtkstaggkitasikwgspvslkeffpae
    megmhtnqflggagvaivasngnlvypvqvtnkkkqvfskifysedegktwkfgkgrsaf
    gcsepvalewegkliintrvdyrrrlvyessdmgntwleavgtlsrvwgpspksnqpgsq
    ssftavtiegmrvmlfthplnfkgrwlrdrlnlwltdnqriynvgqvsigdensayssvl
    ykddklyclheinsnevyslvfarlvgelriiksvlqswknwdshlssictpadpaasss
    ergcgpavttvglvgflshsatktewedayrcvnastanaervpnglkfagvgggalwpv
    sqqgqnqryhfanhaftlvasvtihevpkgaspllgasldssggkkllglsydkrhqwqp
    iygstpvtptgswemgkryhvvltmankigsvyidgeplegsgqtvvpdertpdishfyv
    ggykrsgmptdsrvtvnnvllynrqlnaeeirtlflsqdligteahmd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ms1A (A:)
    lapgssrvelfkrqsskvpfekdgkvtervvhsfrlpalvnvdgvmvaiadaryetsfdn
    slidtvakysvddgetwetqiaiknsrassvsrvvdptvivkgnklyvlvgsynssrsyw
    tshgdardwdillavgevtkstaggkitasikwgspvslkeffpaemegmhtnqflggag
    vaivasngnlvypvqvtnkkkqvfskifysedegktwkfgkgrsafgcsepvalewegkl
    iintrvdyrrrlvyessdmgntwleavgtlsrvwgpspksnqpgsqssftavtiegmrvm
    lfthplnfkgrwlrdrlnlwltdnqriynvgqvsigdensayssvlykddklyclheins
    nevyslvfarlvgelriiksvlqswknwdshlssictpacgpavttvglvgflshsatkt
    ewedayrcvnastanaervpnglkfagvgggalwpvsqqgqnqryhfanhaftlvasvti
    hevpkgaspllgasldssggkkllglsydkrhqwqpiygstpvtptgswemgkryhvvlt
    mankigsvyidgeplegsgqtvvpdertpdishfyvggykrsgmptdsrvtvnnvllynr
    qlnaeeirtlflsqdligteah
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ms1B (B:)
    mggshhhhhhgmaslapgssrvelfkrqsskvpfekdgkvtervvhsfrlpalvnvdgvm
    vaiadaryetsfdnslidtvakysvddgetwetqiaiknsrassvsrvvdptvivkgnkl
    yvlvgsynssrsywtshgdardwdillavgevtkstaggkitasikwgspvslkeffpae
    megmhtnqflggagvaivasngnlvypvqvtnkkkqvfskifysedegktwkfgkgrsaf
    gcsepvalewegkliintrvdyrrrlvyessdmgntwleavgtlsrvwgpspksnqpgsq
    ssftavtiegmrvmlfthplnfkgrwlrdrlnlwltdnqriynvgqvsigdensayssvl
    ykddklyclheinsnevyslvfarlvgelriiksvlqswknwdshlssictpadpaasss
    ergcgpavttvglvgflshsatktewedayrcvnastanaervpnglkfagvgggalwpv
    sqqgqnqryhfanhaftlvasvtihevpkgaspllgasldssggkkllglsydkrhqwqp
    iygstpvtptgswemgkryhvvltmankigsvyidgeplegsgqtvvpdertpdishfyv
    ggykrsgmptdsrvtvnnvllynrqlnaeeirtlflsqdligteahmd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ms1B (B:)
    lapgssrvelfkrqsskvpfekdgkvtervvhsfrlpalvnvdgvmvaiadaryetsfdn
    slidtvakysvddgetwetqiaiknsrassvsrvvdptvivkgnklyvlvgsynssrsyw
    tshgdardwdillavgevtkstaggkitasikwgspvslkeffpaemegmhtnqflggag
    vaivasngnlvypvqvtnkkkqvfskifysedegktwkfgkgrsafgcsepvalewegkl
    iintrvdyrrrlvyessdmgntwleavgtlsrvwgpspksnqpgsqssftavtiegmrvm
    lfthplnfkgrwlrdrlnlwltdnqriynvgqvsigdensayssvlykddklyclheins
    nevyslvfarlvgelriiksvlqswknwdshlssictpacgpavttvglvgflshsatkt
    ewedayrcvnastanaervpnglkfagvgggalwpvsqqgqnqryhfanhaftlvasvti
    hevpkgaspllgasldssggkkllglsydkrhqwqpiygstpvtptgswemgkryhvvlt
    mankigsvyidgeplegsgqtvvpdertpdishfyvggykrsgmptdsrvtvnnvllynr
    qlnaeeirtlflsqdligteah