PDB entry 1mrz

View 1mrz on RCSB PDB site
Description: crystal structure of a flavin binding protein from thermotoga maritima, tm379
Deposited on 2002-09-19, released 2003-09-23
The last revision prior to the SCOP 1.69 freeze date was dated 2004-08-24, with a file datestamp of 2004-08-24.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.217
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1mrzA (A:)
    mvvsigvfdgvhighqkvlrtmkeiaffrkddsliytisyppeyflpdfpgllmtvesrv
    emlsryartvvldffrikdltpegfverylsgvsavvvgrdfrfgknasgnasflrkkgv
    evyeiedvvvqgkrvssslirnlvqegrveeipaylgryfeiegivhkdrefgrklgfpt
    anidrgneklvdlkrgvylvrvhlpdgkkkfgvmnvgfrptvgdarnvkyevyildfegd
    lygqrlklevlkfmrdekkfdsieelkaaidqdvksarnmiddiinskfekeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mrzA (A:)
    vvsigvfdgvhighqkvlrtmkeiaffrkddsliytisyppeyflpdfpgllmtvesrve
    mlsryartvvldffrikdltpegfverylsgvsavvvgrdfrfgknasgnasflrkkgve
    vyeiedvvvqgkrvssslirnlvqegrveeipaylgryfeiegivfptanidrgneklvd
    lkrgvylvrvhlpdgkkkfgvmnvgfrrnvkyevyildfegdlygqrlklevlkfmrdek
    keelkaaidqdvksarnmiddiinsk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1mrzB (B:)
    mvvsigvfdgvhighqkvlrtmkeiaffrkddsliytisyppeyflpdfpgllmtvesrv
    emlsryartvvldffrikdltpegfverylsgvsavvvgrdfrfgknasgnasflrkkgv
    evyeiedvvvqgkrvssslirnlvqegrveeipaylgryfeiegivhkdrefgrklgfpt
    anidrgneklvdlkrgvylvrvhlpdgkkkfgvmnvgfrptvgdarnvkyevyildfegd
    lygqrlklevlkfmrdekkfdsieelkaaidqdvksarnmiddiinskfekeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mrzB (B:)
    vvsigvfdgvhighqkvlrtmkeiaffrkddsliytisyppeyflpdfpgllmtvesrve
    mlsryartvvldffrikdltpegfverylsgvsavvvgrdfrfgknasgnasflrkkgve
    vyeiedvvvqgkrvssslirnlvqegrveeipaylgryfeiegivhfptanidrgneklv
    dlkrgvylvrvhlpdgkkkfgvmnvgfnvkyevyildfegdlygqrlklevlkfmrdekk
    fdsieelkaaidqdvksarnmiddiinskf