PDB entry 1mrz

View 1mrz on RCSB PDB site
Description: Crystal structure of a flavin binding protein from Thermotoga Maritima, TM379
Class: transferase
Keywords: Rossmann fold, flavin binding domain, 6-stranded beta barrel, nucleotide binding domain, Structural Genomics, BSGC structure funded by NIH, Protein Structure Initiative, PSI, Berkeley Structural Genomics Center, TRANSFERASE
Deposited on 2002-09-19, released 2003-09-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.217
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Riboflavin kinase/FMN adenylyltransferase
    Species: Thermotoga maritima [TaxId:2336]
    Gene: TM379
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1mrza1, d1mrza2
  • Chain 'B':
    Compound: Riboflavin kinase/FMN adenylyltransferase
    Species: Thermotoga maritima [TaxId:2336]
    Gene: TM379
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1mrzb1, d1mrzb2
  • Heterogens: CIT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1mrzA (A:)
    mvvsigvfdgvhighqkvlrtmkeiaffrkddsliytisyppeyflpdfpgllmtvesrv
    emlsryartvvldffrikdltpegfverylsgvsavvvgrdfrfgknasgnasflrkkgv
    evyeiedvvvqgkrvssslirnlvqegrveeipaylgryfeiegivhkdrefgrklgfpt
    anidrgneklvdlkrgvylvrvhlpdgkkkfgvmnvgfrptvgdarnvkyevyildfegd
    lygqrlklevlkfmrdekkfdsieelkaaidqdvksarnmiddiinskfekeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mrzA (A:)
    vvsigvfdgvhighqkvlrtmkeiaffrkddsliytisyppeyflpdfpgllmtvesrve
    mlsryartvvldffrikdltpegfverylsgvsavvvgrdfrfgknasgnasflrkkgve
    vyeiedvvvqgkrvssslirnlvqegrveeipaylgryfeiegivfptanidrgneklvd
    lkrgvylvrvhlpdgkkkfgvmnvgfrrnvkyevyildfegdlygqrlklevlkfmrdek
    keelkaaidqdvksarnmiddiinsk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1mrzB (B:)
    mvvsigvfdgvhighqkvlrtmkeiaffrkddsliytisyppeyflpdfpgllmtvesrv
    emlsryartvvldffrikdltpegfverylsgvsavvvgrdfrfgknasgnasflrkkgv
    evyeiedvvvqgkrvssslirnlvqegrveeipaylgryfeiegivhkdrefgrklgfpt
    anidrgneklvdlkrgvylvrvhlpdgkkkfgvmnvgfrptvgdarnvkyevyildfegd
    lygqrlklevlkfmrdekkfdsieelkaaidqdvksarnmiddiinskfekeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mrzB (B:)
    vvsigvfdgvhighqkvlrtmkeiaffrkddsliytisyppeyflpdfpgllmtvesrve
    mlsryartvvldffrikdltpegfverylsgvsavvvgrdfrfgknasgnasflrkkgve
    vyeiedvvvqgkrvssslirnlvqegrveeipaylgryfeiegivhfptanidrgneklv
    dlkrgvylvrvhlpdgkkkfgvmnvgfnvkyevyildfegdlygqrlklevlkfmrdekk
    fdsieelkaaidqdvksarnmiddiinskf