PDB entry 1mry

View 1mry on RCSB PDB site
Description: crystal structure of an inactive akt2 kinase domain
Class: transferase
Keywords: AGC serine threonine kinase, AKT PKB kinase domain, tumorigenesis, x-ray crystal structure, signal transduction, TRANSFERASE
Deposited on 2002-09-18, released 2003-09-23
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.227
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RAC-beta serine/threonine kinase
    Species: Homo sapiens [TaxId:9606]
    Gene: AKT2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1mrya_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1mryA (A:)
    arakvtmndfdylkllgkgtfgkvilvrekatgryyamkilrkeviiakdevahtvtesr
    vlqntrhpfltalkyafqthdrlcfvmeyanggelffhlsrervfteerarfygaeivsa
    leylhsrdvvyrdiklenlmldkdghikitdfglckegisdgatmktfcgtpeylapevl
    edndygravdwwglgvvmyemmcgrlpfynqdherlfelilmeeirfprtlspeakslla
    gllkkdpkqrlgggpsdakevmehrfflsinwqdvvqkkllppfkpqvtsevdtryfdde
    ftaqsititppdrydslglleldqrthfpqfsysasire
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mryA (A:)
    kvtmndfdylkllgkgtfgkvilvrekatgryyamkilrkeviirvlqntrhpfltalky
    afqthdrlcfvmeyanggelffhlsrervfteerarfygaeivsaleylhsrdvvyrdik
    lenlmldkdghikitdfglccgtpeylapevledndygravdwwglgvvmyemmcgrlpf
    ynqdherlfelilmeeirfprtlspeaksllagllkkdpkqrlgggpsdakevmehrffl
    sinwqdvvqkkllppfkpqvtsevdtryfd