PDB entry 1mrg

View 1mrg on RCSB PDB site
Description: studies on crystal structures active center geometry and depurine mechanism of two ribosome-inactivating proteins
Deposited on 1994-07-01, released 1995-02-07
The last revision prior to the SCOP 1.59 freeze date was dated 1995-02-07, with a file datestamp of 1995-02-14.
Experiment type: -
Resolution: 1.8 Å
R-factor: 0.195
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.59: d1mrg__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1mrg_ (-)
    dvsfrlsgadprsygmfikdlrnalpfrekvyniplllpsvsgagryllmhlfnrdgkti
    tvavdvtniyimgyladttsyffnepaaelasqyvfrdarrkitlpysgdyerlqiaagk
    prekipiglpaldsaistllhydstaaagallvliqttaeaarfkyieqqiqerayrdev
    pslatislenswsglskqiqlaqgnngifrtpivlvdnkgnrvqitnvtskvvtsniqll
    lntrni