PDB entry 1mrd

View 1mrd on RCSB PDB site
Description: preparation, characterization and crystallization of an antibody fab fragment that recognizes RNA. crystal structures of native fab and three fab-mononucleotide complexes
Class: immunoglobulin
Keywords: immunoglobulin
Deposited on 1994-06-13, released 1995-02-14
The last revision prior to the SCOP 1.73 freeze date was dated 1995-02-14, with a file datestamp of 2007-06-28.
Experiment type: -
Resolution: 2.3 Å
R-factor: 0.195
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: igg2b-kappa jel103 fab (heavy chain)
    Database cross-references and differences (RAF-indexed):
    • GB AAA51630 (1-214)
      • conflict (12)
      • conflict (15)
      • conflict (19)
      • conflict (24)
      • conflict (30)
      • conflict (33-34)
      • conflict (38)
      • conflict (42)
      • conflict (49)
      • conflict (51)
      • conflict (53-56)
      • conflict (61-62)
      • conflict (71)
      • conflict (92)
      • conflict (94)
      • conflict (98-100)
      • conflict (104)
      • conflict (140)
      • conflict (151)
    Domains in SCOP 1.73: d1mrdh1, d1mrdh2
  • Chain 'L':
    Compound: igg2b-kappa jel103 fab (light chain)
    Database cross-references and differences (RAF-indexed):
    • PIR PC4203 (0-End)
      • conflict (2)
      • conflict (26)
      • conflict (26)
      • conflict (38)
      • conflict (91)
      • conflict (93)
      • conflict (95-96)
      • conflict (157)
      • conflict (171)
    Domains in SCOP 1.73: d1mrdl1, d1mrdl2
  • Heterogens: ZN, IMD, IDP, HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1mrdH (H:)
    qvqlqqsgaelvkpgasvklsckasgytftsywmqwvkqrpgqglewigeidpsdsytny
    nqkfkgkatltvdtssstaymqlssltsedsavyycanlrgyfdywgqgttltvssaktt
    ppsvyplapgcgdttgssvtlgclvkgyfpesvtvtwnsgslsssvhtfpallqsglytm
    sssvtvpsstwpsqtvtcsvahpassttvdkklep
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mrdH (H:)
    vqlqqsgaelvkpgasvklsckasgytftsywmqwvkqrpgqglewigeidpsdsytnyn
    qkfkgkatltvdstaymqlssltsedsavyycanlrgyfdywgqgttltvssakttppsv
    yplapgttgssvtlgclvkgyfpesvtvtwnsgslsssvhtfpallqsglytmsssvtvp
    sstwpsqtvtcsvahpassttvdkklep
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1mrdL (L:)
    dvvmtqtplslpvslgdqasiscrssqslvhsngntylhwylqkpgqspklliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvyfcsqsthvprtfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgkerqngvlnswtdqnskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mrdL (L:)
    dvvmtqtplslpvslgdqasiscrssqslvhsngntylhwylqkpgqspklliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvyfcsqsthvprtfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgkerqngvlnswtdqnskdstysm
    sstltltkdeyerhnsytceathktstspivksfnr