PDB entry 1mrd

View 1mrd on RCSB PDB site
Description:
Deposited on 1994-06-13, released 1995-02-14
The last revision prior to the SCOP 1.65 freeze date was dated 1995-02-14, with a file datestamp of 1995-02-17.
Experiment type: -
Resolution: 2.3 Å
R-factor: 0.195
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1mrdh1, d1mrdh2
  • Chain 'L':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1mrdl1, d1mrdl2

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1mrdH (H:)
    qvqlqqsgaelvkpgasvklsckasgytftsywmqwvkqrpgqglewigeidpsdsytny
    nqkfkgkatltvdtssstaymqlssltsedsavyycanlrgyfdywgqgttltvssaktt
    ppsvyplapgcgdttgssvtlgclvkgyfpesvtvtwnsgslsssvhtfpallqsglytm
    sssvtvpsstwpsqtvtcsvahpassttvdkklep
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mrdH (H:)
    vqlqqsgaelvkpgasvklsckasgytftsywmqwvkqrpgqglewigeidpsdsytnyn
    qkfkgkatltvdstaymqlssltsedsavyycanlrgyfdywgqgttltvssakttppsv
    yplapgttgssvtlgclvkgyfpesvtvtwnsgslsssvhtfpallqsglytmsssvtvp
    sstwpsqtvtcsvahpassttvdkklep
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1mrdL (L:)
    dvvmtqtplslpvslgdqasiscrssqslvhsngntylhwylqkpgqspklliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvyfcsqsthvprtfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgkerqngvlnswtdqnskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mrdL (L:)
    dvvmtqtplslpvslgdqasiscrssqslvhsngntylhwylqkpgqspklliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvyfcsqsthvprtfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgkerqngvlnswtdqnskdstysm
    sstltltkdeyerhnsytceathktstspivksfnr