PDB entry 1mrc

View 1mrc on RCSB PDB site
Description:
Deposited on 1994-06-13, released 1995-02-14
The last revision prior to the SCOP 1.65 freeze date was dated 1995-02-14, with a file datestamp of 1995-02-17.
Experiment type: -
Resolution: 2.4 Å
R-factor: 0.191
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1mrch1, d1mrch2
  • Chain 'L':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.65: d1mrcl1, d1mrcl2

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1mrcH (H:)
    qvqlqqsgaelvkpgasvklsckasgytftsywmqwvkqrpgqglewigeidpsdsytny
    nqkfkgkatltvdtssstaymqlssltsedsavyycanlrgyfdywgqgttltvssaktt
    ppsvyplapgcgdttgssvtlgclvkgyfpesvtvtwnsgslsssvhtfpallqsglytm
    sssvtvpsstwpsqtvtcsvahpassttvdkklep
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mrcH (H:)
    qvqlqqsgaelvkpgasvklsckasgytftsywmqwvkqrpgqglewigeisytnynqkf
    kgkatltvdstaymqlssltsedsavyycanlrgyfdywgqgttltvssakttppsvypl
    apttgssvtlgclvkgyfpesvtvtwnsgslsssvhtfpallqsglytmsssvtvpsstw
    psqtvtcsvahpassttvdkklep
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1mrcL (L:)
    dvvmtqtplslpvslgdqasiscrssqslvhsngntylhwylqkpgqspklliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvyfcsqsthvprtfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgkerqngvlnswtdqnskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mrcL (L:)
    dvvmtqtplslpvslgdqasiscrssqslvhsngntylhwylqkpgqspklliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvyfcsqsthvprtfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgkerqngvlnswtdqnskdstysm
    sstltltkdeyerhnsytceathktstspivksfnr