PDB entry 1mra

View 1mra on RCSB PDB site
Description: mandelate racemase mutant d270n co-crystallized with (s)-atrolactate
Deposited on 1996-03-12, released 1996-08-01
The last revision prior to the SCOP 1.71 freeze date was dated 1996-08-01, with a file datestamp of 1996-08-02.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.19
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain ' ':
    Sequence, based on SEQRES records: (download)
    >1mra_ (-)
    msevlitglrtravnvplaypvhtavgtvgtaplvlidlatsagvvghsylfaytpvalk
    slkqllddmaamivneplapvsleamlakrfclagytglirmaaagidmaawdalgkvhe
    tplvkllganarpvqaydshsldgvklateravtaaelgfravktkigypaldqdlavvr
    sirqavgddfgimvdynqsldvpaaikrsqalqqegvtwieeptlqhdyeghqriqskln
    vpvqmgenwlgpeemfkalsigacrlampnamkiggvtgwirasalaqqfgipmsshlfq
    eisahllaatptahwlerldlagsvieptltfeggnavipdlpgvgiiwrekeigkylv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mra_ (-)
    evlitglrtravnvplaypvhtavgtvgtaplvlidlatsagvvghsylfaytpvalksl
    kqllddmaamivneplapvsleamlakrfclagytglirmaaagidmaawdalgkvhetp
    lvkllganarpvqaydshsldgvklateravtaaelgfravktkigypaldqdlavvrsi
    rqavgddfgimvdynqsldvpaaikrsqalqqegvtwieeptlqhdyeghqriqsklnvp
    vqmgenwlgpeemfkalsigacrlampnamkiggvtgwirasalaqqfgipmsshlfqei
    sahllaatptahwlerldlagsvieptltfeggnavipdlpgvgiiwrekeigkylv