PDB entry 1mr9

View 1mr9 on RCSB PDB site
Description: Crystal structure of Streptogramin A Acetyltransferase with acetyl-CoA bound
Class: transferase
Keywords: left-handed parallel-beta helix domain, TRANSFERASE
Deposited on 2002-09-18, released 2003-08-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.246
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: streptogramin a acetyltransferase
    Species: Enterococcus faecium [TaxId:1352]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P50870 (0-End)
      • modified residue (0)
      • modified residue (5)
      • modified residue (7)
      • modified residue (76)
      • modified residue (83)
      • modified residue (101)
      • modified residue (128)
      • modified residue (153)
    Domains in SCOPe 2.07: d1mr9a_
  • Chain 'B':
    Compound: streptogramin a acetyltransferase
    Species: Enterococcus faecium [TaxId:1352]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P50870 (0-End)
      • modified residue (0)
      • modified residue (5)
      • modified residue (7)
      • modified residue (76)
      • modified residue (83)
      • modified residue (101)
      • modified residue (128)
      • modified residue (153)
    Domains in SCOPe 2.07: d1mr9b_
  • Chain 'C':
    Compound: streptogramin a acetyltransferase
    Species: Enterococcus faecium [TaxId:1352]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P50870 (0-End)
      • modified residue (0)
      • modified residue (5)
      • modified residue (7)
      • modified residue (76)
      • modified residue (83)
      • modified residue (101)
      • modified residue (128)
      • modified residue (153)
    Domains in SCOPe 2.07: d1mr9c_
  • Chain 'X':
    Compound: streptogramin a acetyltransferase
    Species: Enterococcus faecium [TaxId:1352]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P50870 (0-End)
      • modified residue (0)
      • modified residue (5)
      • modified residue (7)
      • modified residue (76)
      • modified residue (83)
      • modified residue (101)
      • modified residue (128)
      • modified residue (153)
    Domains in SCOPe 2.07: d1mr9x_
  • Chain 'Y':
    Compound: streptogramin a acetyltransferase
    Species: Enterococcus faecium [TaxId:1352]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P50870
      • modified residue (5)
      • modified residue (7)
      • modified residue (76)
      • modified residue (83)
      • modified residue (101)
      • modified residue (128)
      • modified residue (153)
    Domains in SCOPe 2.07: d1mr9y_
  • Chain 'Z':
    Compound: streptogramin a acetyltransferase
    Species: Enterococcus faecium [TaxId:1352]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P50870
      • modified residue (5)
      • modified residue (7)
      • modified residue (76)
      • modified residue (83)
      • modified residue (101)
      • modified residue (128)
      • modified residue (153)
    Domains in SCOPe 2.07: d1mr9z_
  • Heterogens: ACO

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1mr9A (A:)
    mgpnpmkmypiegnksvqfikpileklenvevgeysyydskngetfdkqilyhypilndk
    lkigkfcsigpgvtiimnganhrmdgstypfnlfgngwekhmpkldqlpikgdtiigndv
    wigkdvvimpgvkigdgaivaansvvvkdiapymlaggnpaneikqrfdqdtinqlldik
    wwnwpidiinenidkildnsiireviwkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mr9A (A:)
    mgpnpmkmypiegnksvqfikpileklenvevgeysyydskngetfdkqilyhypilndk
    lkigkfcsigpgvtiimnganhrmdgstypfnlfgngwekhmpkldqlpikgdtiigndv
    wigkdvvimpgvkigdgaivaansvvvkdiapymlaggnpaneikqrfdqdtinqlldik
    wwnwpidiinenidkildnsiir
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1mr9B (B:)
    mgpnpmkmypiegnksvqfikpileklenvevgeysyydskngetfdkqilyhypilndk
    lkigkfcsigpgvtiimnganhrmdgstypfnlfgngwekhmpkldqlpikgdtiigndv
    wigkdvvimpgvkigdgaivaansvvvkdiapymlaggnpaneikqrfdqdtinqlldik
    wwnwpidiinenidkildnsiireviwkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mr9B (B:)
    mgpnpmkmypiegnksvqfikpileklenvevgeysyydskngetfdkqilyhypilndk
    lkigkfcsigpgvtiimnganhrmdgstypfnlfgngwekhmpkldqlpikgdtiigndv
    wigkdvvimpgvkigdgaivaansvvvkdiapymlaggnpaneikqrfdqdtinqlldik
    wwnwpidiinenidkildnsiir
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1mr9C (C:)
    mgpnpmkmypiegnksvqfikpileklenvevgeysyydskngetfdkqilyhypilndk
    lkigkfcsigpgvtiimnganhrmdgstypfnlfgngwekhmpkldqlpikgdtiigndv
    wigkdvvimpgvkigdgaivaansvvvkdiapymlaggnpaneikqrfdqdtinqlldik
    wwnwpidiinenidkildnsiireviwkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mr9C (C:)
    mgpnpmkmypiegnksvqfikpileklenvevgeysyydskngetfdkqilyhypilndk
    lkigkfcsigpgvtiimnganhrmdgstypfnlfgngwekhmpkldqlpikgdtiigndv
    wigkdvvimpgvkigdgaivaansvvvkdiapymlaggnpaneikqrfdqdtinqlldik
    wwnwpidiinenidkildnsii
    

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >1mr9X (X:)
    mgpnpmkmypiegnksvqfikpileklenvevgeysyydskngetfdkqilyhypilndk
    lkigkfcsigpgvtiimnganhrmdgstypfnlfgngwekhmpkldqlpikgdtiigndv
    wigkdvvimpgvkigdgaivaansvvvkdiapymlaggnpaneikqrfdqdtinqlldik
    wwnwpidiinenidkildnsiireviwkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mr9X (X:)
    mgpnpmkmypiegnksvqfikpileklenvevgeysyydskngetfdkqilyhypilndk
    lkigkfcsigpgvtiimnganhrmdgstypfnlfgngwekhmpkldqlpikgdtiigndv
    wigkdvvimpgvkigdgaivaansvvvkdiapymlaggnpaneikqrfdqdtinqlldik
    wwnwpidiinenidkildnsiir
    

  • Chain 'Y':
    Sequence, based on SEQRES records: (download)
    >1mr9Y (Y:)
    mgpnpmkmypiegnksvqfikpileklenvevgeysyydskngetfdkqilyhypilndk
    lkigkfcsigpgvtiimnganhrmdgstypfnlfgngwekhmpkldqlpikgdtiigndv
    wigkdvvimpgvkigdgaivaansvvvkdiapymlaggnpaneikqrfdqdtinqlldik
    wwnwpidiinenidkildnsiireviwkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mr9Y (Y:)
    gpnpmkmypiegnksvqfikpileklenvevgeysyydskngetfdkqilyhypilndkl
    kigkfcsigpgvtiimnganhrmdgstypfnlfgngwekhmpkldqlpikgdtiigndvw
    igkdvvimpgvkigdgaivaansvvvkdiapymlaggnpaneikqrfdqdtinqlldikw
    wnwpidinenidkildnsii
    

  • Chain 'Z':
    Sequence, based on SEQRES records: (download)
    >1mr9Z (Z:)
    mgpnpmkmypiegnksvqfikpileklenvevgeysyydskngetfdkqilyhypilndk
    lkigkfcsigpgvtiimnganhrmdgstypfnlfgngwekhmpkldqlpikgdtiigndv
    wigkdvvimpgvkigdgaivaansvvvkdiapymlaggnpaneikqrfdqdtinqlldik
    wwnwpidiinenidkildnsiireviwkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1mr9Z (Z:)
    gpnpmkmypiegnksvqfikpillenvevgeysyydskngetfdkqilyhypilndklki
    gkfcsigpgvtiimnganhrmdgstypfnlfgngwekhmpkldqlpikgdtiigndvwig
    kdvvimpgvkigdgaivaansvvvkdiapymlaggnpaneikqrfdqdtinqlldikwwn
    wpidiinenidkildnsii