PDB entry 1mr6

View 1mr6 on RCSB PDB site
Description: Solution Structure of gamma-Bungarotoxin:Implication for the role of the Residues Adjacent to RGD in Integrin Binding
Class: toxin
Keywords: neurotoxin, venom
Deposited on 2002-09-18, released 2004-05-18
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Neurotoxin
  Species: Bungarus multicinctus [TaxId:8616]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9W796 (0-67)
  Domains in SCOPe 2.06: d1mr6a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1mr6A (A:)
  mqcktcsfytcpnsetcpdgknicvkrswtavrgdgpkreirrecaatcppsklgltvfc
  cttdncnh